SitesBLAST
Comparing AO356_03355 FitnessBrowser__pseudo5_N2C3_1:AO356_03355 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
29% identity, 69% coverage: 3:221/318 of query aligns to 4:235/307 of 6wjaA
- active site: A118 (≠ S111), A119 (≠ I112), A120 (≠ G113), F143 (≠ Y136), K147 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (≠ Y10), I12 (= I11), D31 (vs. gap), D32 (vs. gap), S34 (≠ G28), T35 (≠ I29), G36 (= G30), A55 (≠ D46), L74 (= L65), A75 (= A66), A76 (≠ G67), S93 (≠ A86), F143 (≠ Y136), K147 (= K140), F170 (≠ P163), F171 (≠ P164), I173 (≠ V166)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ I71), A120 (≠ G113), N172 (≠ L165), G186 (= G173), V187 (≠ N174), F191 (≠ L178), T202 (≠ P189), F204 (≠ L191), R211 (= R197)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
29% identity, 69% coverage: 3:221/318 of query aligns to 5:236/308 of 6wj9B
- active site: A119 (≠ S111), A120 (≠ I112), A121 (≠ G113), F144 (≠ Y136), K148 (= K140)
- binding nicotinamide-adenine-dinucleotide: G8 (= G6), G11 (= G9), F12 (≠ Y10), I13 (= I11), D32 (vs. gap), D33 (vs. gap), S35 (≠ G28), T36 (≠ I29), G37 (= G30), D55 (≠ L45), A56 (≠ D46), L75 (= L65), A76 (= A66), A77 (≠ G67), S94 (≠ A86), A117 (≠ I109), A119 (≠ S111), F144 (≠ Y136), K148 (= K140), F171 (≠ P163), F172 (≠ P164), I174 (≠ V166)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ I71), N173 (≠ L165), G187 (= G173), V188 (≠ N174), F192 (≠ L178), T203 (≠ P189), L204 (≠ F190), F205 (≠ L191), R212 (= R197)
Sites not aligning to the query:
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
25% identity, 97% coverage: 3:309/318 of query aligns to 4:310/314 of 6zldA
- active site: T126 (≠ S111), S127 (≠ I112), S128 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (≠ Y10), I12 (= I11), D32 (≠ G30), H33 (≠ R31), F34 (vs. gap), I35 (vs. gap), K43 (vs. gap), D62 (= D46), I63 (≠ L47), L81 (= L65), A82 (= A66), A83 (≠ G67), I124 (= I109), T126 (≠ S111), K153 (= K140), Y176 (≠ P163), T178 (≠ L165), R185 (≠ P172), M188 (vs. gap)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A69), R88 (≠ L72), T126 (≠ S111), S127 (≠ I112), S128 (≠ G113), Y149 (= Y136), F177 (≠ P164), T178 (≠ L165), R185 (≠ P172), M188 (vs. gap), A189 (vs. gap), R192 (= R177), T204 (≠ P189), F206 (≠ L191), Q211 (= Q196), R213 (= R197), I250 (= I251), E276 (vs. gap)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
25% identity, 97% coverage: 3:309/318 of query aligns to 4:310/314 of 6zl6A
- active site: T126 (≠ S111), S127 (≠ I112), S128 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (≠ Y10), I12 (= I11), D32 (≠ G30), H33 (≠ R31), F34 (vs. gap), I35 (vs. gap), K43 (vs. gap), D62 (= D46), I63 (≠ L47), L81 (= L65), A82 (= A66), A83 (≠ G67), I124 (= I109), T126 (≠ S111), K153 (= K140), Y176 (≠ P163), T178 (≠ L165), V179 (= V166), R185 (≠ P172), M188 (vs. gap)
- binding uridine-5'-diphosphate: T178 (≠ L165), A189 (vs. gap), R192 (= R177), T204 (≠ P189), F206 (≠ L191), Q211 (= Q196), R213 (= R197), I250 (= I251), E276 (vs. gap)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
25% identity, 97% coverage: 3:309/318 of query aligns to 4:310/321 of 6zllA
- active site: T126 (≠ S111), S127 (≠ I112), S128 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (≠ Y10), I12 (= I11), D32 (≠ G30), H33 (≠ R31), F34 (vs. gap), I35 (vs. gap), K43 (vs. gap), D62 (= D46), I63 (≠ L47), L81 (= L65), A82 (= A66), A83 (≠ G67), I124 (= I109), T126 (≠ S111), Y149 (= Y136), K153 (= K140), Y176 (≠ P163), V179 (= V166), R185 (≠ P172), M188 (vs. gap)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A69), V87 (≠ I71), R88 (≠ L72), T126 (≠ S111), S127 (≠ I112), Y149 (= Y136), T178 (≠ L165), R185 (≠ P172), A189 (vs. gap), R192 (= R177), T204 (≠ P189), F206 (≠ L191), Q211 (= Q196), R213 (= R197), I250 (= I251), E276 (vs. gap)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
25% identity, 97% coverage: 3:309/318 of query aligns to 4:310/314 of 6zljA
- active site: T126 (≠ S111), S127 (≠ I112), S128 (≠ G113), F149 (≠ Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (≠ Y10), I12 (= I11), D32 (≠ G30), H33 (≠ R31), F34 (vs. gap), I35 (vs. gap), K43 (vs. gap), D62 (= D46), I63 (≠ L47), L81 (= L65), A82 (= A66), A83 (≠ G67), I124 (= I109), T126 (≠ S111), K153 (= K140), Y176 (≠ P163), T178 (≠ L165), V179 (= V166), R185 (≠ P172), M188 (vs. gap)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A69), R88 (≠ L72), T126 (≠ S111), S127 (≠ I112), S128 (≠ G113), F149 (≠ Y136), F177 (≠ P164), T178 (≠ L165), R185 (≠ P172), M188 (vs. gap), A189 (vs. gap), R192 (= R177), T204 (≠ P189), F206 (≠ L191), Q211 (= Q196), R213 (= R197), I250 (= I251), E276 (vs. gap)
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
35% identity, 45% coverage: 1:144/318 of query aligns to 1:145/315 of 3a1nA
- active site: T112 (≠ S111), Y137 (= Y136), K141 (= K140)
- binding nicotinamide-adenine-dinucleotide: S8 (= S8), G9 (= G9), Q10 (≠ Y10), I11 (= I11), D32 (≠ S33), I33 (≠ M34), L46 (= L45), D47 (= D46), L69 (= L65), A70 (= A66), G71 (= G67), L73 (= L72), S111 (= S110), Y137 (= Y136), K141 (= K140)
Sites not aligning to the query:
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
35% identity, 45% coverage: 1:144/318 of query aligns to 1:145/311 of 3a4vA
- active site: T112 (≠ S111), Y137 (= Y136), K141 (= K140)
- binding nicotinamide-adenine-dinucleotide: S8 (= S8), G9 (= G9), Q10 (≠ Y10), I11 (= I11), D32 (≠ S33), I33 (≠ M34), L46 (= L45), D47 (= D46), V48 (≠ L47), L69 (= L65), A70 (= A66), G71 (= G67), L73 (= L72), P110 (≠ I109), S111 (= S110), T112 (≠ S111), Y137 (= Y136), K141 (= K140)
- binding pyruvic acid: S74 (≠ N73), Y137 (= Y136)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
35% identity, 45% coverage: 1:144/318 of query aligns to 1:145/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (= S8), G9 (= G9), Q10 (≠ Y10), I11 (= I11), D32 (≠ S33), I33 (≠ M34), L46 (= L45), D47 (= D46), V48 (≠ L47), L69 (= L65), A70 (= A66), L73 (= L72), V87 (≠ A86), P110 (≠ I109), S111 (= S110), K141 (= K140)
- binding threonine: S74 (≠ N73), T112 (≠ S111), F137 (≠ Y136)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
35% identity, 45% coverage: 1:144/318 of query aligns to 1:145/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (= S8), G9 (= G9), Q10 (≠ Y10), I11 (= I11), D32 (≠ S33), I33 (≠ M34), L46 (= L45), D47 (= D46), V48 (≠ L47), L69 (= L65), A70 (= A66), G71 (= G67), L73 (= L72), P110 (≠ I109), S111 (= S110), T112 (≠ S111), F137 (≠ Y136), K141 (= K140)
- binding (3R)-3-hydroxy-L-norvaline: S74 (≠ N73), T112 (≠ S111), I113 (= I112), F137 (≠ Y136)
Sites not aligning to the query:
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
32% identity, 47% coverage: 3:152/318 of query aligns to 4:165/338 of 2udpA
- active site: S124 (= S111), A125 (≠ I112), T126 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), Y11 (= Y10), I12 (= I11), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (≠ G30), D58 (= D46), I59 (≠ L47), F80 (≠ L65), A81 (= A66), G82 (= G67), K84 (≠ A69), S122 (≠ I109), S124 (= S111), Y149 (= Y136), K153 (= K140)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177
- binding phenyl-uridine-5'-diphosphate: 179, 199, 200, 216, 217, 218, 231, 233, 269, 292, 295
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
32% identity, 47% coverage: 3:152/318 of query aligns to 4:165/338 of 1udcA
- active site: S124 (= S111), A125 (≠ I112), T126 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), Y11 (= Y10), I12 (= I11), D31 (vs. gap), N32 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (≠ G30), D58 (= D46), I59 (≠ L47), F80 (≠ L65), A81 (= A66), G82 (= G67), K84 (≠ A69), S122 (≠ I109), Y149 (= Y136), K153 (= K140)
- binding uridine-5'-diphosphate-mannose: T126 (≠ G113), Y149 (= Y136)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-mannose: 179, 199, 200, 215, 216, 217, 218, 231, 233, 269, 292
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
32% identity, 47% coverage: 3:152/318 of query aligns to 4:165/338 of P09147
- YI 11:12 (= YI 10:11) binding
- DNLCNS 31:36 (≠ -----G 30) binding
- DI 58:59 (≠ DL 46:47) binding
- FAGLK 80:84 (≠ LAGRA 65:69) binding
- N99 (≠ R85) binding
- S124 (= S111) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y136) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K140) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
Sites not aligning to the query:
- 178 binding
- 299 Y→C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
33% identity, 51% coverage: 1:162/318 of query aligns to 1:158/321 of 4id9A
- active site: S106 (= S111), Y132 (= Y136), K136 (= K140)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), R10 (≠ Y10), V11 (≠ I11), D30 (≠ G30), L31 (vs. gap), R32 (= R31), S44 (≠ D46), L45 (= L47), L64 (= L65), A66 (≠ R68), V81 (≠ A86), S106 (= S111), Y132 (= Y136), K136 (= K140)
Sites not aligning to the query:
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
23% identity, 94% coverage: 3:302/318 of query aligns to 4:298/309 of 4zrnA
- active site: T117 (≠ S111), G119 (= G113), A120 (= A116), Y143 (= Y136), K147 (= K140), Y181 (vs. gap), G185 (= G169)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (≠ Y10), I12 (= I11), D31 (≠ G30), N32 (≠ R31), S34 (= S33), S35 (≠ M34), G36 (≠ T35), S51 (≠ D50), I52 (≠ P51), L73 (= L65), A74 (= A66), A75 (≠ G67), T92 (≠ A86), S115 (≠ I109), S116 (= S110), Y143 (= Y136), K147 (= K140), Y170 (≠ P163), V173 (= V166)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S111), G119 (= G113), A120 (= A116), Y143 (= Y136), N172 (≠ L165), G185 (= G169), V186 (≠ S170), H201 (≠ G185), F203 (= F190), Y208 (≠ N195), R210 (= R197), V244 (≠ T233), R267 (vs. gap), D270 (≠ V257)
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
33% identity, 51% coverage: 1:162/318 of query aligns to 2:159/328 of 4id9B
- active site: S107 (= S111), Y133 (= Y136), K137 (= K140)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), R11 (≠ Y10), V12 (≠ I11), D31 (≠ G30), L32 (vs. gap), S45 (≠ D46), L46 (= L47), L65 (= L65), A67 (≠ R68), V82 (≠ A86), Y133 (= Y136), K137 (= K140)
Sites not aligning to the query:
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
32% identity, 47% coverage: 3:152/318 of query aligns to 4:165/338 of 1udaA
- active site: S124 (= S111), A125 (≠ I112), T126 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), Y11 (= Y10), I12 (= I11), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (≠ G30), D58 (= D46), I59 (≠ L47), F80 (≠ L65), A81 (= A66), G82 (= G67), K84 (≠ A69), S122 (≠ I109), Y149 (= Y136), K153 (= K140)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ G113)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: 179, 199, 200, 216, 217, 218, 231, 233, 292, 295, 299
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
32% identity, 47% coverage: 3:152/318 of query aligns to 4:165/338 of 1naiA
- active site: S124 (= S111), A125 (≠ I112), T126 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), Y11 (= Y10), I12 (= I11), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (≠ G30), D58 (= D46), I59 (≠ L47), F80 (≠ L65), A81 (= A66), G82 (= G67), K84 (≠ A69), Y149 (= Y136), K153 (= K140)
- binding 1,3-propandiol: N35 (vs. gap), K84 (≠ A69)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding 1,3-propandiol: 191, 193
- binding uridine-5'-diphosphate: 179, 199, 200, 215, 216, 231, 233, 292
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
32% identity, 47% coverage: 3:152/318 of query aligns to 4:165/338 of 1lrjA
- active site: S124 (= S111), A125 (≠ I112), T126 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), Y11 (= Y10), I12 (= I11), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (≠ G30), D58 (= D46), I59 (≠ L47), F80 (≠ L65), A81 (= A66), G82 (= G67), K84 (≠ A69), Y149 (= Y136), K153 (= K140)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (≠ I71), S124 (= S111)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-diphosphate-n-acetylglucosamine: 178, 179, 200, 215, 216, 218, 231, 233, 269, 292, 295
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
31% identity, 47% coverage: 3:152/318 of query aligns to 4:165/338 of 1kvrA
- active site: A124 (≠ S111), A125 (≠ I112), T126 (≠ G113), Y149 (= Y136), K153 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), Y11 (= Y10), I12 (= I11), D31 (vs. gap), N32 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (≠ G30), D58 (= D46), I59 (≠ L47), F80 (≠ L65), A81 (= A66), G82 (= G67), K84 (≠ A69), S122 (≠ I109), S123 (= S110), Y149 (= Y136), K153 (= K140)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate: 179, 198, 199, 200, 216, 217, 218, 231, 233, 269, 292, 295
Query Sequence
>AO356_03355 FitnessBrowser__pseudo5_N2C3_1:AO356_03355
MQLVTGASGYIGSLLCKVLKARGYAVKGIGRSSMTPSQDFDYVCLDLENDPLDGVCLGVE
TIVHLAGRAHILNDKEEDPLSAFRRANVNATLRLAEEAMRGGVKRFVFISSIGVSATETK
NSKVSELSGNNPSTPYALSKFEAEEALKALVKDSSMELVIIRPPLVYGGSAPGNFHRLLK
IVRLGMPLPFLAANNQRSMIALDNLIDFIVHCIKHPAAAGELFLISDGTDVSTVDIVRTI
ANGMGRKPRLIYVPVGVIRVAAKLLGRENMFSQLFGSLVIDSGKAHQLLGWTPPLGTTEA
LSKAGADYMTLSSKKGRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory