Comparing AO356_11540 FitnessBrowser__pseudo5_N2C3_1:AO356_11540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q12390 Glutathione S-transferase 2; GST-II; EC 2.5.1.18 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
73% identity, 89% coverage: 16:220/231 of query aligns to 19:223/233 of Q12390
3ibhA Crystal structure of saccharomyces cerevisiae gtt2 in complex with glutathione (see paper)
73% identity, 89% coverage: 16:220/231 of query aligns to 1:205/208 of 3ibhA
3ergA Crystal structure of gtt2 from saccharomyces cerevisiae in complex with glutathione sulfnate (see paper)
73% identity, 89% coverage: 16:220/231 of query aligns to 1:205/208 of 3ergA
3touA Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound
27% identity, 88% coverage: 16:218/231 of query aligns to 2:196/212 of 3touA
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
29% identity, 84% coverage: 28:220/231 of query aligns to 14:205/213 of 5f06A
Sites not aligning to the query:
4g9hA Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione
29% identity, 82% coverage: 32:220/231 of query aligns to 18:194/202 of 4g9hA
Sites not aligning to the query:
2dsaA Ternary complex of bphk, a bacterial gst (see paper)
28% identity, 89% coverage: 16:221/231 of query aligns to 1:193/200 of 2dsaA
2gdrA Crystal structure of a bacterial glutathione transferase (see paper)
28% identity, 89% coverage: 16:221/231 of query aligns to 1:193/202 of 2gdrA
1pmtA Glutathione transferase from proteus mirabilis (see paper)
28% identity, 93% coverage: 16:229/231 of query aligns to 1:199/201 of 1pmtA
P15214 Glutathione S-transferase GST-6.0; GST B1-1; EC 2.5.1.18 from Proteus mirabilis (see paper)
28% identity, 93% coverage: 16:229/231 of query aligns to 1:199/203 of P15214
4e8hB Structural of bombyx mori glutathione transferase bmgstd1 complex with gtt
25% identity, 75% coverage: 13:186/231 of query aligns to 2:166/216 of 4e8hB
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
27% identity, 73% coverage: 18:186/231 of query aligns to 8:167/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
27% identity, 73% coverage: 18:186/231 of query aligns to 5:164/212 of 2cz2A
4zb6D Crystal structure of glutathione transferase ure2p4 from phanerochaete chrysosporium in complex with oxidized glutathione. (see paper)
27% identity, 92% coverage: 18:230/231 of query aligns to 7:219/220 of 4zb6D
7rhpA Crystal structure of honeybee (apis mellifera) glutathione s- transferase amgstd1 (see paper)
28% identity, 71% coverage: 24:187/231 of query aligns to 15:168/215 of 7rhpA
8agqA Crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione (see paper)
31% identity, 69% coverage: 27:186/231 of query aligns to 13:169/213 of 8agqA
Sites not aligning to the query:
1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
28% identity, 72% coverage: 21:187/231 of query aligns to 5:161/207 of 1jlvA
4i97A The crystal structure of glutathione s-transferase sniggstd1a from scaptomyza nigrita in complex with glutathione
29% identity, 72% coverage: 24:189/231 of query aligns to 8:163/207 of 4i97A
4mk3A Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
25% identity, 76% coverage: 16:191/231 of query aligns to 1:166/203 of 4mk3A
6f01B Arabidopsis thaliana gstf9, gso3 and gsoh bound (see paper)
25% identity, 90% coverage: 15:222/231 of query aligns to 1:193/212 of 6f01B
>AO356_11540 FitnessBrowser__pseudo5_N2C3_1:AO356_11540
MTSPQQRVDVSTVPTMKIYDWFNGPYPARVRIALAEKGLLPNIEFVPVNLWAGEHKKPEF
LAINYSGTLPVLELDDGTRIAECTAITQYLDSLDGHPTLTGETPVEKGIIHMMTKRAEIE
FLDAVSAYFHHATPGLGPDVELYQNAEWGARMRDKAIRGMRYFDNLLKDRPFVAGDKFSM
ADIAVLGGMIFASLVQLPVPEECVALRAWHARMQERSSVQTWRAMVERGAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory