Comparing AO356_25650 FitnessBrowser__pseudo5_N2C3_1:AO356_25650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
36% identity, 88% coverage: 27:257/263 of query aligns to 1:228/229 of 5t0wA
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
33% identity, 87% coverage: 27:256/263 of query aligns to 2:231/237 of 5kkwA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
27% identity, 85% coverage: 35:258/263 of query aligns to 3:227/234 of 3k4uE
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
29% identity, 85% coverage: 35:258/263 of query aligns to 3:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
28% identity, 85% coverage: 35:258/263 of query aligns to 3:226/226 of 4zv1A
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
29% identity, 85% coverage: 27:250/263 of query aligns to 2:228/240 of 4h5fA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
25% identity, 87% coverage: 29:258/263 of query aligns to 3:228/229 of 6svfA
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
35% identity, 33% coverage: 29:116/263 of query aligns to 2:89/130 of 7a99B
Sites not aligning to the query:
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
24% identity, 86% coverage: 38:262/263 of query aligns to 5:254/255 of 5itoA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
24% identity, 86% coverage: 38:262/263 of query aligns to 4:253/256 of 5otcA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
24% identity, 86% coverage: 38:262/263 of query aligns to 4:253/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
24% identity, 86% coverage: 38:262/263 of query aligns to 4:253/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
24% identity, 86% coverage: 38:262/263 of query aligns to 4:253/254 of 4powA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
24% identity, 86% coverage: 38:262/263 of query aligns to 5:254/259 of 5ovzA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
24% identity, 84% coverage: 36:257/263 of query aligns to 1:222/224 of 4ymxA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
34% identity, 32% coverage: 27:110/263 of query aligns to 5:89/240 of 2ylnA
Sites not aligning to the query:
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
23% identity, 86% coverage: 29:253/263 of query aligns to 1:227/237 of 4i62A
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
24% identity, 84% coverage: 38:257/263 of query aligns to 28:253/260 of P0AEU0
Sites not aligning to the query:
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
24% identity, 84% coverage: 38:257/263 of query aligns to 28:253/260 of P02911
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
24% identity, 84% coverage: 38:257/263 of query aligns to 6:231/238 of 1lstA
>AO356_25650 FitnessBrowser__pseudo5_N2C3_1:AO356_25650
MKTITSSMTFCGLLALSCGALAEPAPSLLDQVLQRGELKVCTTGDYKPYTFKTEAGEYEG
IDIDMARSLAASLGVKVQWVQTTWKTLMPDMVAGQCDIGMGGISVTLERQKKAYFSTTLD
VDGKIPLVRCEDKERYQTLEQMNQPSVRLVEPAGGTNEAFVRAFLPNGQLSFHDNVTIFQ
QLLDKKADVMITDASEALYQQKLKPGLCAVNPTRYLQYGEKAYLLPRDDNTWKMYVDQWL
HLSKANGSYQKVIGQWLAVPATQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory