Comparing AO356_27160 FitnessBrowser__pseudo5_N2C3_1:AO356_27160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
31% identity, 98% coverage: 4:294/297 of query aligns to 5:290/291 of 3na8A
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
28% identity, 79% coverage: 10:243/297 of query aligns to 10:239/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
28% identity, 79% coverage: 10:243/297 of query aligns to 10:239/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
28% identity, 79% coverage: 10:243/297 of query aligns to 10:239/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
28% identity, 79% coverage: 10:243/297 of query aligns to 10:239/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
28% identity, 79% coverage: 10:243/297 of query aligns to 10:239/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
28% identity, 79% coverage: 10:243/297 of query aligns to 10:239/291 of 3pueB
Sites not aligning to the query:
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 97% coverage: 1:287/297 of query aligns to 1:281/292 of Q07607
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 85% coverage: 1:251/297 of query aligns to 1:249/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
30% identity, 85% coverage: 1:251/297 of query aligns to 1:249/294 of Q8UGL3
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
27% identity, 97% coverage: 10:297/297 of query aligns to 12:294/296 of 7kg2A
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
27% identity, 97% coverage: 10:297/297 of query aligns to 22:304/306 of 7kkdB
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
27% identity, 97% coverage: 10:297/297 of query aligns to 12:294/296 of 4m19A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
27% identity, 97% coverage: 10:297/297 of query aligns to 12:294/296 of 6u01B
4pfmA Shewanella benthica dhdps with lysine and pyruvate
27% identity, 95% coverage: 1:282/297 of query aligns to 2:278/295 of 4pfmA
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
25% identity, 98% coverage: 1:292/297 of query aligns to 2:288/293 of 5t25A
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
27% identity, 84% coverage: 1:249/297 of query aligns to 1:249/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
27% identity, 84% coverage: 1:249/297 of query aligns to 2:250/295 of 1o5kA
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
25% identity, 98% coverage: 1:292/297 of query aligns to 1:287/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
25% identity, 98% coverage: 1:292/297 of query aligns to 1:287/292 of P0A6L2
>AO356_27160 FitnessBrowser__pseudo5_N2C3_1:AO356_27160
MFTGLSAFPLTPMDEQGVDEIAFARLVQQLVAAKVDSIGALGSTGSYAYLSRAERFRVAQ
LAVEAAEDVPVMVSIGALRTRDVLLLAEDAQAVGVQALLLPPVSYQKLTQDDVFSMYEMV
SANISVPLCVYDNPGTTHFEFSDELHRRIAELPNVRSIKIPGVPEAPYLAKERVERLRKL
IPSHVTIGISGDASAAVGMNAGCDAWYSVMGGLFPNTALAITRAALSGDALEATRLSESL
KPLWALFSQFGGSFRVIATAAELRGFTHSASVPLPLRTIDGEGREQIAAVIEALELS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory