Comparing AO356_28530 FitnessBrowser__pseudo5_N2C3_1:AO356_28530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
4eayA Crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate (see paper)
66% identity, 99% coverage: 1:388/391 of query aligns to 3:391/395 of 4eayA
4eacC Crystal structure of mannonate dehydratase from escherichia coli strain k12 (see paper)
66% identity, 99% coverage: 1:388/391 of query aligns to 3:391/396 of 4eacC
3dbnA Crystal structure of the streptoccocus suis serotype2 d- mannonate dehydratase in complex with its substrate (see paper)
37% identity, 100% coverage: 1:391/391 of query aligns to 3:337/349 of 3dbnA
3bdkA Crystal structure of streptococcus suis mannonate dehydratase complexed with substrate analogue
37% identity, 100% coverage: 1:391/391 of query aligns to 3:337/349 of 3bdkA
>AO356_28530 FitnessBrowser__pseudo5_N2C3_1:AO356_28530
MEQTWRWFGPKDPISLADIRQTGATGIVTALHEIPNGEVWPVDAIAARKQLIEAAGLSWS
VVESIPVHEDIKRGCGRRDEYIANYQQSVRNLASCGIDIVCYNFMPVLDWTRTDLSFELA
DGGWALRFDQTAFAAFDLFILQRPGAQAEYSAEDIQQAKAYFEQLTPARRETLVNTLIAG
LPGAEEHYSLDNFRDLLRTYADIDEAKLREHLGYFLRAVIPVAEAVGVRMAIHPDDPPRA
LLGLPRILSTAEDAQWLLDAAPSPANGLTFCTGSYGVREDNDLVAMAKHFAPFIYFTHLR
STRRETDPRSFHEAHHLDGDVDMVGVIGALVAEERRREREGGPRLPLRPDHGHQLLDDQH
RKSNPGYSLIGRLKGLAEIRGVELAVRRQLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory