SitesBLAST
Comparing AO356_28540 FitnessBrowser__pseudo5_N2C3_1:AO356_28540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
31% identity, 92% coverage: 3:399/430 of query aligns to 11:417/430 of P0AA76
- Y29 (= Y21) binding
- D31 (= D23) mutation to N: Loss of galactonate transport activity.
- R32 (= R24) binding
- Y64 (= Y56) binding
- E118 (= E110) mutation to Q: Loss of galactonate transport activity.
- W358 (= W339) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
31% identity, 92% coverage: 6:399/430 of query aligns to 3:398/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
30% identity, 92% coverage: 3:399/430 of query aligns to 3:382/393 of 6e9oA
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
25% identity, 86% coverage: 36:406/430 of query aligns to 99:479/495 of Q9NRA2
- K136 (= K73) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ S118) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AI 133:134) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LR 196:197) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ AEGQG 198:202) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (≠ S258) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P264) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ C300) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 85% coverage: 36:399/430 of query aligns to 99:472/495 of Q5Q0U0
- K136 (= K73) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R103) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ F106) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G107) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E110) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (= G111) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ S114) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (≠ V115) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ S118) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ V121) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ AEGQG 198:202) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P264) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (≠ C300) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
26% identity, 85% coverage: 36:399/430 of query aligns to 99:472/495 of Q8BN82
- H183 (≠ S118) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
27% identity, 56% coverage: 46:285/430 of query aligns to 84:337/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
23% identity, 84% coverage: 38:399/430 of query aligns to 103:475/497 of Q9Y2C5
- A372 (≠ V298) to T: in dbSNP:rs11754288
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 62% coverage: 18:285/430 of query aligns to 95:376/582 of Q9JI12
- H128 (≠ F49) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R103) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E110) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ Y231) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
24% identity, 62% coverage: 18:285/430 of query aligns to 37:318/452 of 7t3nA
Sites not aligning to the query:
A2SWM2 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2; Protein two of hearts from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
24% identity, 85% coverage: 12:376/430 of query aligns to 60:435/504 of A2SWM2
- R153 (= R103) mutation to S: In ko157; displays cardia bifida (2 hearts).
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
28% identity, 56% coverage: 8:246/430 of query aligns to 15:242/403 of P77589
- E27 (≠ N20) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D68) mutation D->A,E: Lack of 3HPP transport activity.
Sites not aligning to the query:
- 272 A→H: 30% increase in 3HPP transport activity.
- 276 K→D: Lack of 3HPP transport activity.
Q8IVW8 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2 from Homo sapiens (Human) (see 2 papers)
24% identity, 87% coverage: 2:376/430 of query aligns to 97:482/549 of Q8IVW8
- R200 (= R103) mutation to S: Loss of function; does not rescue the cardia bifida phenotype in the morpholino knockdown in zebrafish.
- S319 (= S225) natural variant: Missing (in DFNB115; uncertain significance; dbSNP:rs749994718)
7yubR S1p-bound human spns2 (see paper)
24% identity, 87% coverage: 2:376/430 of query aligns to 5:370/429 of 7yubR
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 75% coverage: 9:329/430 of query aligns to 23:351/452 of Q5EXK5
- D82 (= D68) mutation to A: Loss of activity.
- V311 (≠ F277) mutation to W: Loss of activity.
- D314 (= D280) mutation to A: Loss of activity.
7yudR Fty720p-bound human spns2 (see paper)
24% identity, 87% coverage: 5:376/430 of query aligns to 1:358/417 of 7yudR
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
21% identity, 81% coverage: 3:350/430 of query aligns to 110:459/605 of Q9GQQ0
- E217 (= E110) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
8jhqA Cryo-em structure of human s1p transporter spns2 bound with s1p (see paper)
23% identity, 87% coverage: 2:376/430 of query aligns to 3:387/446 of 8jhqA
8g92A Structure of inhibitor 16d-bound spns2 (see paper)
24% identity, 87% coverage: 4:376/430 of query aligns to 1:358/415 of 8g92A
Q6ZSM3 Monocarboxylate transporter 12; MCT 12; Creatine transporter 2; CRT2; Solute carrier family 16 member 12 from Homo sapiens (Human) (see 3 papers)
25% identity, 70% coverage: 120:420/430 of query aligns to 163:478/516 of Q6ZSM3
- D329 (≠ G268) mutation to A: Decreases creatine efflux activity. Loss of localization to the plasma membrane.
- D360 (≠ T299) mutation to A: Does not affect creatine efflux activity. Does not affect plasma membrane localization.
- D387 (≠ T334) mutation to A: Does not affect creatine efflux activity.
- G437 (= G381) to S: found in a patient with age-related cataract; uncertain significance; decreases creatine transport; dbSNP:rs759863805
Sites not aligning to the query:
- 67 R→A: Abolishes creatine efflux activity. Does not affect plasma membrane localization.
- 95 D→A: Decreases in the creatine efflux activity. Does not affect plasma membrane localization.
- 245:516 natural variant: Missing (in CTRCT47; loss of localization to the plasma membrane; retained in the endoplasmic reticulum where it undergoes degradation by the proteasome; has no dominant effect on wild-type protein expression and localization)
Query Sequence
>AO356_28540 FitnessBrowser__pseudo5_N2C3_1:AO356_28540
MFGQGRSLIIIMLFLAGVINYLDRSALSVAAPFIQKDYGLSTGEMGMIFSSFFVGYAAFN
FIGGWAADRYGAKTTLLLAMVLWSLFSGLTVLTVGFASLVLIRILFGMGEGPLSVTTSKM
VNNWYTPKRRARAIGASMSGTPLGGAISGPVVGFIAVTYGWKISFIIIMLIGLVWAAVWF
KFVKERPEGEGAEDILRAEGQGELAAQPVFPLRFYLKQPTVLFTSLAFFSYNYTLFFFLT
WFPSYLTMAHGLNVKDMSIATVIPWVLGFLGLALGGFISDFVFKKTGRMMFSRKVVLVTC
LLACAVCIACAGMVTTLYPAVILVALAVFFLYLTGAIYWAIIQDTVPAARVGGVSGFMHF
LANTSGIVGPTLTGFLVQFTGSFTSAFLLAGLLTVIGAVCVARYVKPLSVADTGNAAAQS
PQPVSALGRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory