SitesBLAST
Comparing AO356_28690 FitnessBrowser__pseudo5_N2C3_1:AO356_28690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7orxCCC jostii RHA1 thiamine diphosphate-dependent 4-hydroxybenzoylformate decarboxylase
26% identity, 97% coverage: 13:511/513 of query aligns to 17:524/531 of 7orxCCC
- active site: N26 (= N22), G28 (= G24), S29 (≠ T25), N30 (≠ T26), E31 (= E27), E50 (= E48), H73 (= H71), M112 (≠ P110), L113 (= L111), S114 (≠ A112), N115 (≠ S113), Y163 (≠ M160), P257 (vs. gap), H284 (≠ E282), S379 (≠ G359), G404 (= G384), L406 (≠ I386), D431 (= D411), N458 (= N438), T460 (≠ R440), Y461 (= Y441), A463 (≠ I443), L464 (= L444), F467 (≠ E447)
- binding thiamine diphosphate: N26 (= N22), S29 (≠ T25), E50 (= E48), H73 (= H71), T380 (≠ G360), S381 (≠ T361), G404 (= G384), L406 (≠ I386), G430 (≠ S410), G432 (= G412), S433 (= S413), Y436 (= Y416), N458 (= N438), T460 (≠ R440), Y461 (= Y441), G462 (≠ A442)
4q9dB X-ray structure of a putative thiamin diphosphate-dependent enzyme isolated from mycobacterium smegmatis (see paper)
26% identity, 96% coverage: 15:509/513 of query aligns to 17:513/519 of 4q9dB
- active site: N24 (= N22), G26 (= G24), S27 (≠ T25), T28 (= T26), E29 (= E27), Q47 (≠ F47), E48 (= E48), H71 (= H71), V107 (≠ Y107), D108 (= D108), Y110 (≠ P110), L111 (= L111), N112 (≠ A112), N113 (≠ S113), L161 (≠ M160), P252 (= P251), Y279 (≠ F279), M374 (≠ V357), S376 (≠ G359), G401 (= G384), I403 (= I386), D432 (= D411), N459 (= N438), E461 (≠ R440), Y462 (= Y441), I464 (= I443)
- binding magnesium ion: D432 (= D411), N459 (= N438), E461 (≠ R440)
Sites not aligning to the query:
6a50A Structure of benzoylformate decarboxylases in complex with cofactor tpp
25% identity, 97% coverage: 15:512/513 of query aligns to 16:522/527 of 6a50A
- binding magnesium ion: N117 (≠ A117), L118 (= L118), R120 (≠ G120), D428 (= D411), N455 (= N438), T457 (≠ R440)
- binding thiamine diphosphate: N23 (= N22), P24 (= P23), E47 (= E48), H70 (= H71), T377 (≠ G360), S378 (≠ T361), G401 (= G384), L403 (≠ I386), G427 (≠ S410), D428 (= D411), G429 (= G412), S430 (= S413), Y433 (= Y416), N455 (= N438), T457 (≠ R440), Y458 (= Y441), G459 (≠ A442), M460 (≠ I443), L461 (= L448)
3fznA Intermediate analogue in benzoylformate decarboxylase (see paper)
25% identity, 97% coverage: 15:512/513 of query aligns to 15:521/523 of 3fznA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ T26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (≠ A112), N111 (≠ S113), Y159 (≠ M160), P253 (= P251), H280 (≠ F279), S375 (≠ G359), G400 (= G384), L402 (≠ I386), D427 (= D411), N454 (= N438), T456 (≠ R440), Y457 (= Y441), A459 (≠ E447), L460 (= L448), F463 (= F451)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: N22 (= N22), P23 (= P23), G24 (= G24), S25 (≠ T25), E46 (= E48), H69 (= H71), H280 (≠ F279), T376 (≠ G360), S377 (≠ T361), G400 (= G384), L402 (≠ I386), G426 (≠ S410), D427 (= D411), G428 (= G412), S429 (= S413), Y432 (= Y416), N454 (= N438), T456 (≠ R440), Y457 (= Y441), G458 (≠ A442), A459 (≠ E447)
- binding magnesium ion: D427 (= D411), N454 (= N438), T456 (≠ R440)
- binding phosphate ion: Q286 (≠ S286), L288 (= L288), K289 (≠ A289), P290 (≠ E290)
1bfdA Benzoylformate decarboxylase from pseudomonas putida (see paper)
25% identity, 97% coverage: 15:512/513 of query aligns to 15:521/523 of 1bfdA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ T26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (≠ A112), N111 (≠ S113), Y159 (≠ M160), P253 (= P251), H280 (≠ F279), S375 (≠ G359), G400 (= G384), L402 (≠ I386), D427 (= D411), N454 (= N438), T456 (≠ R440), Y457 (= Y441), A459 (≠ E447), L460 (= L448), F463 (= F451)
- binding calcium ion: D427 (= D411), N454 (= N438), T456 (≠ R440)
- binding magnesium ion: N116 (≠ A117), L117 (= L118), R119 (≠ G120)
- binding thiamine diphosphate: T376 (≠ G360), S377 (≠ T361), L402 (≠ I386), G426 (≠ S410), D427 (= D411), G428 (= G412), S429 (= S413), Y432 (= Y416), T456 (≠ R440), Y457 (= Y441), G458 (≠ A442), A459 (≠ E447), L460 (= L448)
3f6bX Crystal structure of benzoylformate decarboxylase in complex with the pyridyl inhibitor paa (see paper)
25% identity, 97% coverage: 15:512/513 of query aligns to 15:521/525 of 3f6bX
- active site: G24 (= G24), E46 (= E48), L108 (≠ P110), L109 (= L111), T110 (≠ A112), N111 (≠ S113), G400 (= G384), D427 (= D411), N454 (= N438), T456 (≠ R440), Y457 (= Y441), A459 (≠ E447), L460 (= L448)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2-[(1S,2E)-1-hydroxy-3-pyridin-3-ylprop-2-en-1-yl]-4-methyl-1,3-thiazol-3-ium: N22 (= N22), P23 (= P23), G24 (= G24), S25 (≠ T25), E46 (= E48), H69 (= H71)
Sites not aligning to the query:
5deiA Benzoylformate decarboxylase from pseudomonas putida
25% identity, 97% coverage: 15:512/513 of query aligns to 15:521/524 of 5deiA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ T26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (≠ A112), N111 (≠ S113), Y159 (≠ M160), P253 (= P251), H280 (≠ F279), S375 (≠ G359), G400 (= G384), L402 (≠ I386), D427 (= D411), N454 (= N438), T456 (≠ R440), Y457 (= Y441), A459 (≠ E447), L460 (= L448), F463 (= F451)
- binding bicarbonate ion: S25 (≠ T25), H69 (= H71), L109 (= L111)
- binding calcium ion: N185 (≠ A184), D186 (≠ G185), D427 (= D411), N454 (= N438), T456 (≠ R440)
- binding magnesium ion: N116 (≠ A117), L117 (= L118), R119 (≠ G120)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (≠ G360), S377 (≠ T361), L402 (≠ I386), G426 (≠ S410), D427 (= D411), G428 (= G412), S429 (= S413), Y432 (= Y416), T456 (≠ R440), Y457 (= Y441), G458 (≠ A442), A459 (≠ E447), L460 (= L448)
Sites not aligning to the query:
3fsjX Crystal structure of benzoylformate decarboxylase in complex with the inhibitor mbp (see paper)
25% identity, 97% coverage: 15:512/513 of query aligns to 15:521/524 of 3fsjX
- active site: G24 (= G24), S25 (≠ T25), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (≠ A112), N111 (≠ S113), H280 (≠ F279), G400 (= G384), D427 (= D411), N454 (= N438), T456 (≠ R440), Y457 (= Y441), A459 (≠ E447), L460 (= L448)
- binding calcium ion: D427 (= D411), N454 (= N438), T456 (≠ R440)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: H280 (≠ F279), T376 (≠ G360), S377 (≠ T361), F396 (vs. gap), G400 (= G384), L402 (≠ I386), G426 (≠ S410), D427 (= D411), G428 (= G412), S429 (= S413), Y432 (= Y416), T456 (≠ R440), Y457 (= Y441), G458 (≠ A442), A459 (≠ E447), L460 (= L448), F463 (= F451)
Sites not aligning to the query:
1mczA Benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate (see paper)
25% identity, 97% coverage: 15:512/513 of query aligns to 15:521/524 of 1mczA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ T26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (≠ A112), N111 (≠ S113), Y159 (≠ M160), P253 (= P251), H280 (≠ F279), S375 (≠ G359), G400 (= G384), L402 (≠ I386), D427 (= D411), N454 (= N438), T456 (≠ R440), Y457 (= Y441), A459 (≠ E447), L460 (= L448), F463 (= F451)
- binding magnesium ion: N116 (≠ A117), L117 (= L118), R119 (≠ G120), D427 (= D411), N454 (= N438), T456 (≠ R440)
- binding (r)-mandelic acid: S25 (≠ T25), H69 (= H71), L109 (= L111), H280 (≠ F279), T376 (≠ G360), F463 (= F451)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (≠ G360), S377 (≠ T361), G400 (= G384), L402 (≠ I386), G426 (≠ S410), D427 (= D411), G428 (= G412), S429 (= S413), Y432 (= Y416), Y457 (= Y441), G458 (≠ A442), A459 (≠ E447), L460 (= L448)
Sites not aligning to the query:
1pi3A E28q mutant benzoylformate decarboxylase from pseudomonas putida
24% identity, 97% coverage: 15:512/513 of query aligns to 15:521/523 of 1pi3A
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ T26), Q27 (≠ E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (≠ A112), N111 (≠ S113), Y159 (≠ M160), P253 (= P251), H280 (≠ F279), S375 (≠ G359), G400 (= G384), L402 (≠ I386), D427 (= D411), N454 (= N438), T456 (≠ R440), Y457 (= Y441), A459 (≠ E447), L460 (= L448), F463 (= F451)
- binding calcium ion: D427 (= D411), N454 (= N438), T456 (≠ R440)
- binding magnesium ion: N116 (≠ A117), L117 (= L118), R119 (≠ G120)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: T376 (≠ G360), S377 (≠ T361), L402 (≠ I386), G426 (≠ S410), G428 (= G412), S429 (= S413), Y432 (= Y416), N454 (= N438), T456 (≠ R440), Y457 (= Y441), G458 (≠ A442), A459 (≠ E447), L460 (= L448)
6qsiA Pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4- hydroxybenzoylformate decarboxylase (see paper)
27% identity, 97% coverage: 15:511/513 of query aligns to 15:520/525 of 6qsiA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ T26), E27 (= E27), E46 (= E48), H69 (= H71), M108 (≠ P110), L109 (= L111), A110 (= A112), Y159 (≠ M160), P253 (vs. gap), H280 (≠ E282), S375 (≠ G359), G400 (= G384), L402 (≠ I386), Y457 (= Y441), A459 (≠ E447), L460 (= L448), F463 (= F451)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (≠ G360), S377 (≠ T361), L402 (≠ I386), G426 (≠ S410), G428 (= G412), S429 (= S413), Y432 (= Y416), N454 (= N438), T456 (≠ R440), Y457 (= Y441), G458 (≠ N446), A459 (≠ E447), L460 (= L448)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
23% identity, 99% coverage: 2:511/513 of query aligns to 13:554/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ Y252), R292 (≠ S277), W489 (≠ E447)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ T361), G401 (≠ C362), Q402 (≠ G363), H403 (≠ Y364), G426 (= G384), M428 (≠ I386), G452 (≠ S410), D453 (= D411), G454 (= G412), S455 (= S413), L483 (≠ Y441), G484 (≠ A442), M485 (≠ I443), V486 (≠ L444)
- binding flavin-adenine dinucleotide: R161 (≠ N150), G222 (= G206), G223 (≠ D207), G224 (≠ Q208), T246 (≠ E232), L247 (≠ T233), M248 (≠ F234), M263 (≠ R249), L264 (= L250), M266 (≠ Y252), H267 (≠ F253), G286 (= G271), R288 (≠ P273), V293 (≠ Y278), D310 (≠ L294), I311 (≠ L295), D329 (= D303), V330 (= V304), M405 (≠ F366), G423 (= G383)
- binding magnesium ion: A37 (≠ T26), T82 (≠ H71), S83 (≠ L72), Q122 (≠ L111), Y381 (≠ S340), D453 (= D411), M458 (≠ Y416), Q461 (= Q419), N480 (= N438), H482 (≠ R440), K533 (≠ N490)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
23% identity, 99% coverage: 2:511/513 of query aligns to 98:639/670 of P17597
- A122 (≠ T26) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ I28) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E48) binding
- S186 (≠ N90) binding
- P197 (≠ A101) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ W103) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (≠ L111) binding
- K220 (= K124) binding
- R246 (≠ N150) binding ; binding
- K256 (≠ M160) binding
- G308 (≠ D207) binding
- TL 331:332 (≠ ET 232:233) binding
- C340 (≠ G241) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ LPYF 250:253) binding
- GVRFD 371:375 (≠ GVPEP 271:275) binding
- DR 376:377 (≠ IS 276:277) binding
- DI 395:396 (≠ LL 294:295) binding
- DV 414:415 (= DV 303:304) binding
- QH 487:488 (≠ GY 363:364) binding
- GG 508:509 (≠ G- 383) binding
- GAM 511:513 (≠ GAI 384:386) binding
- D538 (= D411) binding
- DGS 538:540 (= DGS 411:413) binding
- N565 (= N438) binding
- NQHLGM 565:570 (≠ NHRYAI 438:443) binding
- H567 (≠ R440) binding
- W574 (≠ E447) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
23% identity, 99% coverage: 2:511/513 of query aligns to 13:554/585 of 5k2oA
- active site: Y33 (≠ N22), G35 (= G24), G36 (≠ T25), A37 (≠ T26), S38 (≠ E27), E59 (= E48), T82 (≠ H71), F121 (≠ P110), Q122 (≠ L111), E123 (≠ A112), K171 (≠ M160), M266 (≠ Y252), V293 (≠ Y278), V400 (≠ T361), G426 (= G384), M428 (≠ I386), D453 (= D411), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), M485 (≠ I443), V486 (≠ L444), W489 (≠ E447)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ Y252), R292 (≠ S277), W489 (≠ E447)
- binding flavin-adenine dinucleotide: R161 (≠ N150), G222 (= G206), G223 (≠ D207), G224 (≠ Q208), T246 (≠ E232), L247 (≠ T233), M248 (≠ F234), L264 (= L250), G286 (= G271), R288 (≠ P273), D290 (≠ P275), V293 (≠ Y278), D310 (≠ L294), I311 (≠ L295), D329 (= D303), V330 (= V304), Q404 (≠ P365), M405 (≠ F366), G423 (= G383)
- binding magnesium ion: D453 (= D411), N480 (= N438), H482 (≠ R440)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ T361), G401 (≠ C362), Q402 (≠ G363), H403 (≠ Y364), M428 (≠ I386), D453 (= D411), G454 (= G412), S455 (= S413), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), G484 (≠ A442), M485 (≠ I443), V486 (≠ L444)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
23% identity, 99% coverage: 2:511/513 of query aligns to 13:554/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ T361), G401 (≠ C362), Q402 (≠ G363), H403 (≠ Y364), G426 (= G384), M428 (≠ I386), G452 (≠ S410), D453 (= D411), G454 (= G412), S455 (= S413), M458 (≠ Y416), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), G484 (≠ A442), M485 (≠ I443), V486 (≠ L444)
- binding flavin-adenine dinucleotide: R161 (≠ N150), G222 (= G206), G223 (≠ D207), G224 (≠ Q208), T246 (≠ E232), L247 (≠ T233), M248 (≠ F234), L264 (= L250), M266 (≠ Y252), H267 (≠ F253), G286 (= G271), V287 (= V272), R288 (≠ P273), D290 (≠ P275), R292 (≠ S277), V293 (≠ Y278), D310 (≠ L294), I311 (≠ L295), D329 (= D303), V330 (= V304), M405 (≠ F366), G423 (= G383)
- binding magnesium ion: F370 (≠ E333), D453 (= D411), M458 (≠ Y416), Q461 (= Q419), N480 (= N438), H482 (≠ R440), K533 (≠ N490)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ Y252), R292 (≠ S277), M485 (≠ I443), W489 (≠ E447)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
23% identity, 99% coverage: 2:511/513 of query aligns to 13:554/582 of 5wj1A
- active site: Y33 (≠ N22), G35 (= G24), G36 (≠ T25), A37 (≠ T26), S38 (≠ E27), E59 (= E48), T82 (≠ H71), F121 (≠ P110), Q122 (≠ L111), E123 (≠ A112), K171 (≠ M160), M266 (≠ Y252), V293 (≠ Y278), V400 (≠ T361), G426 (= G384), M428 (≠ I386), D453 (= D411), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), M485 (≠ I443), V486 (≠ L444), W489 (≠ E447)
- binding flavin-adenine dinucleotide: R161 (≠ N150), G222 (= G206), G223 (≠ D207), G224 (≠ Q208), T246 (≠ E232), L247 (≠ T233), M248 (≠ F234), M263 (≠ R249), L264 (= L250), G286 (= G271), R288 (≠ P273), V293 (≠ Y278), D310 (≠ L294), I311 (≠ L295), D329 (= D303), V330 (= V304), M405 (≠ F366), G423 (= G383), G424 (vs. gap)
- binding magnesium ion: D453 (= D411), N480 (= N438), H482 (≠ R440)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ Y252), D291 (≠ I276), R292 (≠ S277), M485 (≠ I443), W489 (≠ E447)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ T361), G401 (≠ C362), Q402 (≠ G363), H403 (≠ Y364), M428 (≠ I386), D453 (= D411), G454 (= G412), S455 (= S413), M458 (≠ Y416), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), G484 (≠ A442), M485 (≠ I443), V486 (≠ L444)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
23% identity, 99% coverage: 2:511/513 of query aligns to 13:554/582 of 5k6tA
- active site: Y33 (≠ N22), G35 (= G24), G36 (≠ T25), A37 (≠ T26), S38 (≠ E27), E59 (= E48), T82 (≠ H71), F121 (≠ P110), Q122 (≠ L111), E123 (≠ A112), K171 (≠ M160), M266 (≠ Y252), V293 (≠ Y278), V400 (≠ T361), G426 (= G384), M428 (≠ I386), D453 (= D411), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), M485 (≠ I443), V486 (≠ L444), W489 (≠ E447)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ F253), R292 (≠ S277), M485 (≠ I443), W489 (≠ E447)
- binding flavin-adenine dinucleotide: R161 (≠ N150), G222 (= G206), G223 (≠ D207), G224 (≠ Q208), T246 (≠ E232), L247 (≠ T233), M248 (≠ F234), L264 (= L250), G286 (= G271), R288 (≠ P273), D290 (≠ P275), R292 (≠ S277), V293 (≠ Y278), D310 (≠ L294), I311 (≠ L295), D329 (= D303), V330 (= V304), Q404 (≠ P365), M405 (≠ F366), G423 (= G383)
- binding magnesium ion: D453 (= D411), N480 (= N438), H482 (≠ R440)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ T361), G401 (≠ C362), Q402 (≠ G363), H403 (≠ Y364), G426 (= G384), M428 (≠ I386), G452 (≠ S410), G454 (= G412), S455 (= S413), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), G484 (≠ A442)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
23% identity, 99% coverage: 2:511/513 of query aligns to 13:554/582 of 5k6rA
- active site: Y33 (≠ N22), G35 (= G24), G36 (≠ T25), A37 (≠ T26), S38 (≠ E27), E59 (= E48), T82 (≠ H71), F121 (≠ P110), Q122 (≠ L111), E123 (≠ A112), K171 (≠ M160), M266 (≠ Y252), V293 (≠ Y278), V400 (≠ T361), G426 (= G384), M428 (≠ I386), D453 (= D411), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), M485 (≠ I443), V486 (≠ L444), W489 (≠ E447)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ S277), W489 (≠ E447)
- binding flavin-adenine dinucleotide: R161 (≠ N150), G222 (= G206), G223 (≠ D207), G224 (≠ Q208), T246 (≠ E232), L247 (≠ T233), M248 (≠ F234), L264 (= L250), M266 (≠ Y252), G286 (= G271), R288 (≠ P273), R292 (≠ S277), V293 (≠ Y278), D310 (≠ L294), I311 (≠ L295), G328 (vs. gap), D329 (= D303), V330 (= V304), M405 (≠ F366), G423 (= G383)
- binding magnesium ion: D453 (= D411), N480 (= N438), H482 (≠ R440)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ T361), G401 (≠ C362), Q402 (≠ G363), H403 (≠ Y364), G426 (= G384), M428 (≠ I386), D453 (= D411), G454 (= G412), S455 (= S413), M458 (≠ Y416), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), G484 (≠ A442), M485 (≠ I443), V486 (≠ L444)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
23% identity, 99% coverage: 2:511/513 of query aligns to 13:554/582 of 1z8nA
- active site: Y33 (≠ N22), G35 (= G24), G36 (≠ T25), A37 (≠ T26), S38 (≠ E27), E59 (= E48), T82 (≠ H71), F121 (≠ P110), Q122 (≠ L111), E123 (≠ A112), K171 (≠ M160), M266 (≠ Y252), V293 (≠ Y278), V400 (≠ T361), G426 (= G384), M428 (≠ I386), D453 (= D411), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), M485 (≠ I443), V486 (≠ L444), W489 (≠ E447)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K124), R161 (≠ N150), Y191 (≠ P179), R194 (= R182), D291 (≠ I276), R292 (≠ S277), D312 (≠ C296), W489 (≠ E447)
- binding flavin-adenine dinucleotide: R161 (≠ N150), G222 (= G206), G224 (≠ Q208), T246 (≠ E232), L247 (≠ T233), M248 (≠ F234), L264 (= L250), G265 (≠ P251), M266 (≠ Y252), H267 (≠ F253), G286 (= G271), V287 (= V272), R288 (≠ P273), D290 (≠ P275), R292 (≠ S277), V293 (≠ Y278), D310 (≠ L294), I311 (≠ L295), D329 (= D303), V330 (= V304), M405 (≠ F366), G423 (= G383), G424 (vs. gap)
- binding magnesium ion: D453 (= D411), N480 (= N438)
- binding thiamine diphosphate: V400 (≠ T361), G401 (≠ C362), Q402 (≠ G363), H403 (≠ Y364), G426 (= G384), M428 (≠ I386), G452 (≠ S410), G454 (= G412), S455 (= S413), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), G484 (≠ A442), M485 (≠ I443), V486 (≠ L444)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
23% identity, 99% coverage: 2:511/513 of query aligns to 13:554/582 of 1yi1A
- active site: Y33 (≠ N22), G35 (= G24), G36 (≠ T25), A37 (≠ T26), S38 (≠ E27), E59 (= E48), T82 (≠ H71), F121 (≠ P110), Q122 (≠ L111), E123 (≠ A112), K171 (≠ M160), M266 (≠ Y252), V293 (≠ Y278), V400 (≠ T361), G426 (= G384), M428 (≠ I386), D453 (= D411), N480 (= N438), H482 (≠ R440), L483 (≠ Y441), M485 (≠ I443), V486 (≠ L444), W489 (≠ E447)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ I276), R292 (≠ S277), W489 (≠ E447)
- binding flavin-adenine dinucleotide: R161 (≠ N150), G223 (≠ D207), G224 (≠ Q208), T246 (≠ E232), L247 (≠ T233), M248 (≠ F234), M263 (≠ R249), L264 (= L250), G265 (≠ P251), M266 (≠ Y252), H267 (≠ F253), G286 (= G271), V287 (= V272), R288 (≠ P273), D290 (≠ P275), V293 (≠ Y278), D310 (≠ L294), I311 (≠ L295), D329 (= D303), V330 (= V304), M405 (≠ F366), G423 (= G383), G424 (vs. gap)
- binding magnesium ion: D453 (= D411), N480 (= N438), H482 (≠ R440)
Sites not aligning to the query:
Query Sequence
>AO356_28690 FitnessBrowser__pseudo5_N2C3_1:AO356_28690
MNGAQLIVKAAVASGIEYCFANPGTTEIPLVAAMASAPALKPVLSLFEGVCTGAADGYGR
IAGKPAMTLTHLGPGFANGIANLHNARRANTPIVNVIGDHASWHVNYDPPLASDIQALAG
SVSKWVRTSRTASGVGEDFQEAVRAAWQANGQIASLILPMDLQANTVQHEKAFTALQAPV
RRFAGDRVEAVAQALRDGRRLVFIVGDQGLSVAGLEAAGRLAQLPGVRLFAETFPRLSYR
GGGLPDLDRLPYFPEVAIEILDQYDAVVCAGVPEPISYFGYEGIASRLAERERLLCLAEV
GDDVAGALTALADALEAPAYVPTPTGIELPPGEATLTPQSVGQVLAASLPDDCIVSVEGG
TCGYPFFTASAHAARHRVLTNTGGAIGQGIPVGFGAAMAERGNKVFCLQSDGSAQYTIQT
LWSIAREQLPVVILIAANHRYAILQNELRRFGMTELGPEALSLTVLDRPRIDWKALAKGY
GLPASTVHTNGELQRALANAKADGGPCLIEMAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory