SitesBLAST
Comparing AZOBR_RS00495 FitnessBrowser__azobra:AZOBR_RS00495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
32% identity, 96% coverage: 10:242/242 of query aligns to 10:243/250 of 5bt9C
- active site: R18 (= R18), I140 (= I139), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R18), I19 (≠ V19), C38 (≠ Y38), N39 (≠ R39), R40 (≠ T40), S41 (≠ P41), L66 (= L60), E67 (≠ D64), N90 (= N86), S92 (= S88), I140 (= I139), K159 (= K158), P184 (= P183), G185 (= G184), T187 (≠ I186), L188 (= L187)
6rx5A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 1 (nmt- c0003) (see paper)
30% identity, 96% coverage: 9:241/242 of query aligns to 4:255/258 of 6rx5A
- active site: R13 (= R18), D151 (= D141), Y164 (= Y154), K168 (= K158)
- binding methyl 1-(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}benzoyl)piperidine-4-carboxylate: R13 (= R18), S94 (= S88), F96 (= F90), P98 (≠ V92), F161 (= F151), Y164 (= Y154), P200 (≠ K189), W211 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), H32 (= H37), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T116 (≠ V110), L149 (≠ I139), K168 (= K158), P194 (= P183), G195 (= G184), S197 (≠ I186)
6gd0A Trypanosoma brucei ptr1 in complex with inhibitor 4g (f133) (see paper)
30% identity, 96% coverage: 9:241/242 of query aligns to 4:251/254 of 6gd0A
- active site: R13 (= R18), D147 (= D141), Y160 (= Y154), K164 (= K158)
- binding methyl 1-[4-[[(2-azanyl-1,3-benzothiazol-6-yl)carbonylamino]methyl]phenyl]carbonylpiperidine-4-carboxylate: S94 (= S88), F96 (= F90), C154 (≠ N148), Y160 (= Y154), A198 (≠ W191), M199 (≠ H192), W207 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), S94 (= S88), T117 (≠ V110), L145 (≠ I139), K164 (= K158), P190 (= P183), G191 (= G184), V192 (≠ P185), S193 (≠ I186), L194 (= L187)
3bmoA Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor (compound ax4) (see paper)
30% identity, 96% coverage: 9:241/242 of query aligns to 4:252/255 of 3bmoA
- active site: R13 (= R18), D148 (= D141), Y161 (= Y154), K165 (= K158)
- binding 6-[(4-methylphenyl)sulfanyl]pyrimidine-2,4-diamine: S94 (= S88), F96 (= F90), Y161 (= Y154), L196 (≠ F188), P197 (≠ K189), W208 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T117 (≠ V110), L146 (≠ I139), K165 (= K158), P191 (= P183), G192 (= G184), V193 (≠ P185), S194 (≠ I186)
2c7vC Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate (see paper)
30% identity, 96% coverage: 9:241/242 of query aligns to 4:257/260 of 2c7vC
- active site: R13 (= R18), D153 (= D141), Y166 (= Y154), K170 (= K158)
- binding methotrexate: R13 (= R18), S94 (= S88), F96 (= F90), P98 (≠ V92), Y166 (= Y154), P202 (≠ K189), M205 (≠ H192), W213 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), H32 (= H37), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T118 (≠ V112), L151 (≠ I139), C152 (≠ T140), K170 (= K158), P196 (= P183), S199 (≠ I186)
6rx6A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 4 (nmt- c0026) (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:245/248 of 6rx6A
- active site: R13 (= R18), D141 (= D141), Y154 (= Y154), K158 (= K158)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-(3-oxidanylpropyl)amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R18), S94 (= S88), F96 (= F90), Y154 (= Y154), P190 (≠ K189), M193 (≠ H192), W201 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T115 (≠ V110), L139 (≠ I139), K158 (= K158), P184 (= P183), G185 (= G184), S187 (≠ I186)
6rx0A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 3 (nmt- c0013) (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:245/248 of 6rx0A
- active site: R13 (= R18), D141 (= D141), Y154 (= Y154), K158 (= K158)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-ethyl-amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R18), S94 (= S88), F96 (= F90), P98 (≠ V92), F151 (= F151), Y154 (= Y154), P190 (≠ K189), M193 (≠ H192), W201 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T115 (≠ V110), L139 (≠ I139), K158 (= K158), P184 (= P183), S187 (≠ I186)
6howA Trypanosoma brucei ptr1 in complex with the triazine inhibitor 2a (f219). (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:245/248 of 6howA
- active site: R13 (= R18), D141 (= D141), Y154 (= Y154), K158 (= K158)
- binding (2~{R})-1-(3,4-dichlorophenyl)-2-(4-nitrophenyl)-2~{H}-1,3,5-triazine-4,6-diamine: S94 (= S88), F96 (= F90), Y154 (= Y154), L189 (≠ F188), P190 (≠ K189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T115 (≠ V110), L139 (≠ I139), D141 (= D141), K158 (= K158), G185 (= G184), V186 (≠ P185), S187 (≠ I186)
6gexA Trypanosoma brucei ptr1 in complex with inhibitor 2h (f246) (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:245/248 of 6gexA
- active site: R13 (= R18), D141 (= D141), Y154 (= Y154), K158 (= K158)
- binding 4-[(2-azanyl-1,3-benzothiazol-6-yl)sulfanylmethyl]-~{N}-(phenylmethyl)benzamide: S94 (= S88), F96 (= F90), C148 (≠ N148), Y154 (= Y154), P190 (≠ K189), M193 (≠ H192), W201 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), S94 (= S88), T115 (≠ V110), L139 (≠ I139), K158 (= K158), P184 (= P183), G185 (= G184), S187 (≠ I186), L188 (= L187)
6gdoA Trypanosoma brucei ptr1 in complex with inhibitor 2g (f240) (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:245/248 of 6gdoA
- active site: R13 (= R18), D141 (= D141), Y154 (= Y154), K158 (= K158)
- binding methyl 1-[4-[(2-azanyl-1,3-benzothiazol-6-yl)sulfanylmethyl]phenyl]carbonylpiperidine-4-carboxylate: S94 (= S88), F96 (= F90), C148 (≠ N148), Y154 (= Y154), M193 (≠ H192), W201 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T115 (≠ V110), L139 (≠ I139), D141 (= D141), K158 (= K158), P184 (= P183), G185 (= G184), S187 (≠ I186), L188 (= L187)
5k6aA Trypanosoma brucei pteridine reductase 1 (ptr1) in complex with compound 1 (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:245/248 of 5k6aA
- active site: R13 (= R18), D141 (= D141), Y154 (= Y154), K158 (= K158)
- binding (2~{R})-2-(3-hydroxyphenyl)-6-oxidanyl-2,3-dihydrochromen-4-one: S94 (= S88), F96 (= F90), Y154 (= Y154), V186 (≠ P185), P190 (≠ K189), W201 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T115 (≠ V110), L139 (≠ I139), D141 (= D141), K158 (= K158), G185 (= G184), S187 (≠ I186), L188 (= L187)
3gn1C Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor (ddd00067116) (see paper)
30% identity, 96% coverage: 9:241/242 of query aligns to 4:245/248 of 3gn1C
- active site: R13 (= R18), D141 (= D141), Y154 (= Y154), K158 (= K158)
- binding 1H-benzimidazol-2-amine: F96 (= F90), Y154 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), H32 (= H37), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T116 (≠ V110), L139 (≠ I139), C140 (≠ T140), D141 (= D141), K158 (= K158), P184 (= P183), G185 (= G184), V186 (≠ P185), S187 (≠ I186)
8of2A Trypanosoma brucei pteridine reductase 1 (tbptr1) in complex with 2,4, 6 triamminopyrimidine (tap) (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:246/249 of 8of2A
- binding pyrimidine-2,4,6-triamine: S94 (= S88), F96 (= F90), Y155 (= Y154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), S94 (= S88), T116 (≠ V110), L140 (≠ I139), K159 (= K158), P185 (= P183), G186 (= G184), S188 (≠ I186), L189 (= L187)
6tbxA Trypanosoma brucei ptr1 (tbptr1) in complex with a tricyclic-based inhibitor (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:246/249 of 6tbxA
- active site: R13 (= R18), D142 (= D141), Y155 (= Y154), K159 (= K158)
- binding 2,4-bis(azanyl)-9~{H}-pyrimido[4,5-b]indol-6-ol: S94 (= S88), F96 (= F90), Y155 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), S94 (= S88), T116 (≠ V110), L140 (≠ I139), D142 (= D141), K159 (= K158), P185 (= P183), G186 (= G184), V187 (≠ P185), S188 (≠ I186)
6hnrA Trypanosoma brucei ptr1 in complex with the triazine inhibitor 1 (f217) (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:246/249 of 6hnrA
- active site: R13 (= R18), D142 (= D141), Y155 (= Y154), K159 (= K158)
- binding 1-(3,4-dichlorophenyl)-6,6-dimethyl-1,3,5-triazine-2,4-diamine: S94 (= S88), F96 (= F90), Y155 (= Y154), V187 (≠ P185)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), H32 (= H37), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T116 (≠ V110), L140 (≠ I139), D142 (= D141), K159 (= K158), P185 (= P183), G186 (= G184), S188 (≠ I186), L189 (= L187)
6hncA Trypanosoma brucei ptr1 in complex with cycloguanil (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:246/249 of 6hncA
- active site: R13 (= R18), D142 (= D141), Y155 (= Y154), K159 (= K158)
- binding 1-(4-chlorophenyl)-6,6-dimethyl-1,6-dihydro-1,3,5-triazine-2,4-diamine: S94 (= S88), F96 (= F90), Y155 (= Y154), W202 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), H32 (= H37), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T116 (≠ V110), L140 (≠ I139), D142 (= D141), K159 (= K158), P185 (= P183), S188 (≠ I186)
5jdiA Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt- h024 (compound 2) (see paper)
31% identity, 96% coverage: 9:241/242 of query aligns to 4:246/249 of 5jdiA
- active site: R13 (= R18), D142 (= D141), Y155 (= Y154), K159 (= K158)
- binding 3,6-dihydroxy-2-(3-hydroxyphenyl)-4H-1-benzopyran-4-one: S94 (= S88), F96 (= F90), Y155 (= Y154), L189 (= L187), L190 (≠ F188), P191 (≠ K189), W202 (≠ V200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T116 (≠ V110), L140 (≠ I139), D142 (= D141), K159 (= K158), G186 (= G184), S188 (≠ I186), L189 (= L187)
4cmiA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
30% identity, 96% coverage: 9:241/242 of query aligns to 4:247/250 of 4cmiA
- active site: R13 (= R18), D143 (= D141), Y156 (= Y154), K160 (= K158)
- binding 2-amino-6-(4-bromophenyl)-5-phenyl-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one: S94 (= S88), F96 (= F90), M145 (≠ Y143), C150 (≠ N148), Y156 (= Y154), L191 (≠ F188), P192 (≠ K189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), L62 (= L60), N92 (= N86), S94 (= S88), T116 (≠ V110), L141 (≠ I139), C142 (≠ T140), K160 (= K158), P186 (= P183), G187 (= G184), S189 (≠ I186)
4cmgA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
30% identity, 96% coverage: 9:241/242 of query aligns to 4:247/250 of 4cmgA
- active site: R13 (= R18), D143 (= D141), Y156 (= Y154), K160 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), Y33 (= Y38), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T116 (≠ V110), L141 (≠ I139), C142 (≠ T140), K160 (= K158), P186 (= P183), V188 (≠ P185), S189 (≠ I186)
- binding 6-(4-fluorophenyl)-5-(4-methoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S88), F96 (= F90), M145 (≠ Y143), C150 (≠ N148), Y156 (= Y154), G187 (= G184), L191 (≠ F188), M195 (≠ H192), W203 (≠ V200)
4cmaA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
30% identity, 96% coverage: 9:241/242 of query aligns to 4:247/250 of 4cmaA
- active site: R13 (= R18), D143 (= D141), Y156 (= Y154), K160 (= K158)
- binding 5,6-diphenyl-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S88), F96 (= F90), D143 (= D141), M145 (≠ Y143), C150 (≠ N148), Y156 (= Y154), G187 (= G184), L191 (≠ F188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R18), I14 (≠ V19), H34 (≠ R39), N35 (≠ T40), S36 (≠ P41), D61 (= D59), L62 (= L60), N92 (= N86), A93 (= A87), S94 (= S88), T116 (≠ V110), L141 (≠ I139), K160 (= K158), P186 (= P183), V188 (≠ P185), S189 (≠ I186)
Query Sequence
>AZOBR_RS00495 FitnessBrowser__azobra:AZOBR_RS00495
MTASLLQDAVLVTGAGRRVGLHLAERMMALGHPVIAHYRTPTDGVERLRAAGAVCLQGDL
ADPDGGPRLAEAVRAVAGSLRAVIHNASAFEVTAPDTADALRQLDVFHAVHVRAPFALNR
ELAPLLDACSARRADIVHITDIYADNPNPAFDAYCASKAGLQNLALSFAKRLAPKVKVNV
VQPGPILFKEWHGPEARARVLSETLLGEEGGVEAIGMAVEAILRNHYQTGAVVAVDGGRR
LA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory