Comparing AZOBR_RS02325 FitnessBrowser__azobra:AZOBR_RS02325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23847 Dipeptide-binding protein; DBP; Periplasmic dipeptide transport protein from Escherichia coli (strain K12) (see 4 papers)
32% identity, 78% coverage: 10:402/503 of query aligns to 3:425/535 of P23847
Sites not aligning to the query:
1dppA Dipeptide binding protein complex with glycyl-l-leucine (see paper)
32% identity, 72% coverage: 39:402/503 of query aligns to 3:397/507 of 1dppA
Sites not aligning to the query:
6hlxA Structure of the pbp agaa in complex with agropinic acid from a.Tumefacien r10 (see paper)
35% identity, 74% coverage: 39:409/503 of query aligns to 3:376/491 of 6hlxA
Sites not aligning to the query:
6ofqA Abc transporter-associated periplasmic binding protein dppa from helicobacter pylori in complex with peptide stsa (see paper)
30% identity, 80% coverage: 63:465/503 of query aligns to 35:474/512 of 6ofqA
Sites not aligning to the query:
5f1qA Crystal structure of periplasmic dipeptide transport protein from yersinia pestis
30% identity, 77% coverage: 80:465/503 of query aligns to 45:470/513 of 5f1qA
Sites not aligning to the query:
3m8uA Crystal structure of glutathione-binding protein a (gbpa) from haemophilus parasuis sh0165 in complex with glutathione disulfide (gssg) (see paper)
31% identity, 77% coverage: 81:465/503 of query aligns to 47:470/508 of 3m8uA
Sites not aligning to the query:
6tfxB Structure in p21 form of the pbp/sbp moaa in complex with mannopinic acid from a.Tumefacien r10 (see paper)
30% identity, 86% coverage: 36:466/503 of query aligns to 2:452/494 of 6tfxB
Sites not aligning to the query:
6tfsA Structure in p3212 form of the pbp/sbp moaa in complex with glucopinic acid from a.Tumefacien r10 (see paper)
30% identity, 86% coverage: 36:466/503 of query aligns to 2:452/493 of 6tfsA
Sites not aligning to the query:
6tfqA Structure in p3212 form of the pbp/sbp moaa in complex with mannopinic acid from a.Tumefacien r10 (see paper)
30% identity, 86% coverage: 36:466/503 of query aligns to 2:452/493 of 6tfqA
Sites not aligning to the query:
1uqwA Crystal structure of ylib protein from escherichia coi
29% identity, 90% coverage: 38:488/503 of query aligns to 4:473/487 of 1uqwA
7kz9A Crystal structure of pseudomonas sp. Pdc86 substrate-binding protein aapf in complex with a signaling molecule heheaa (see paper)
29% identity, 90% coverage: 39:489/503 of query aligns to 4:465/478 of 7kz9A
8upiA Structure of a periplasmic peptide binding protein from mesorhizobium sp. Ap09 bound to aminoserine
36% identity, 64% coverage: 69:389/503 of query aligns to 40:375/510 of 8upiA
Sites not aligning to the query:
1xocA The structure of the oligopeptide-binding protein, appa, from bacillus subtilis in complex with a nonapeptide. (see paper)
29% identity, 72% coverage: 38:398/503 of query aligns to 7:389/504 of 1xocA
Sites not aligning to the query:
4qfpA Crystal structure of dipeptide binding protein from pseudoalteromonas sp. Sm9913 in complex with val-thr (see paper)
28% identity, 72% coverage: 39:398/503 of query aligns to 3:393/507 of 4qfpA
Sites not aligning to the query:
4qfoA Crystal structure of dipeptide binding protein from pseudoalteromonas sp. Sm9913 in complex with met-leu (see paper)
28% identity, 72% coverage: 39:398/503 of query aligns to 3:393/507 of 4qfoA
Sites not aligning to the query:
4qfnA Crystal structure of dipeptide binding protein from pseudoalteromonas sp. Sm9913 in complex with gly-glu (see paper)
28% identity, 72% coverage: 39:398/503 of query aligns to 3:393/507 of 4qfnA
Sites not aligning to the query:
4qflA Crystal structure of dipeptide binding protein from pseudoalteromonas sp. Sm9913 in complex with ala-phe (see paper)
28% identity, 72% coverage: 39:398/503 of query aligns to 3:393/507 of 4qflA
Sites not aligning to the query:
2nooA Crystal structure of mutant nika (see paper)
31% identity, 63% coverage: 68:386/503 of query aligns to 30:370/496 of 2nooA
Sites not aligning to the query:
1zlqA Crystallographic and spectroscopic evidence for high affinity binding of fe edta (h2o)- to the periplasmic nickel transporter nika (see paper)
31% identity, 63% coverage: 68:386/503 of query aligns to 31:371/499 of 1zlqA
Sites not aligning to the query:
7a0cA X-ray structure of nika from escherichia coli in complex with fe-6- me2-bpmcn (see paper)
31% identity, 63% coverage: 68:386/503 of query aligns to 32:372/498 of 7a0cA
Sites not aligning to the query:
>AZOBR_RS02325 FitnessBrowser__azobra:AZOBR_RS02325
MPNRQRRTALAITMGAVLGLAGALVAGPVLAQTAPRTDLVVGMRLEPPHLDPTAGAAAAI
DEVTYANLYEPLTRIDAEGKVVPGLAEKWEVSADGLTYTFHLRKGAKFHDGSDADSADVT
FSLDRARGAESVNAQKGYFAAIAGVEAPDARTVVVTLSRPDGLFLFHMASGDAAIVAPES
AGANKQTPVGTGPFKFERWVAGDRVVLVRNPDYDGPKPALERVTFRFISDPAAQVAALKA
GDIDSFPQFDTYEALPQFRDDGAFTVMVGTTEGETILGTNNARKPFDDVRVRRAMAHAID
RKTLIDGVLFGNGAAIGSHFPPHRAGYVDLTGLYPYDPDKAKALLAEAGLPDGFETTLRL
PPPIYARRSGELIAAMLAEVGIRVKIEPMEWAPWLEQVFKGKDYDLTLIAHTEPLDIDIY
GRPDYYFNYRSERFNAVGAELDRTQDPAKRNALYGEQQRILAEDAVNGFLFMLPSATVQK
SAVQGMWVNRPIQANDVTGVRWK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory