SitesBLAST
Comparing AZOBR_RS05475 FitnessBrowser__azobra:AZOBR_RS05475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
47% identity, 93% coverage: 18:350/359 of query aligns to 62:390/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (= L139), R200 (= R159), M281 (≠ K241), G282 (= G242), R307 (= R267), A308 (≠ P268), Q320 (= Q280), V321 (= V281), G322 (= G282), Q323 (= Q283), T324 (= T284), G337 (= G297), I338 (= I298), S339 (= S299), Q343 (= Q303), H344 (= H304), N358 (= N318), K359 (≠ T319), L377 (≠ A337)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
50% identity, 91% coverage: 18:345/359 of query aligns to 1:324/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (= T140), R140 (= R159), T142 (= T161), G219 (= G240), K220 (= K241), G221 (= G242), S245 (≠ T266), R246 (= R267), A247 (≠ P268), Q259 (= Q280), V260 (= V281), G261 (= G282), Q262 (= Q283), T263 (= T284), G276 (= G297), S278 (= S299), Q282 (= Q303), H283 (= H304), N297 (= N318), I298 (≠ T319), L316 (≠ A337)
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
42% identity, 94% coverage: 24:359/359 of query aligns to 4:331/331 of 5ol2A
- binding calcium ion: E75 (≠ D98), D188 (= D211)
- binding flavin-adenine dinucleotide: T117 (= T140), R136 (= R159), I147 (= I170), G216 (= G240), R217 (≠ K241), G218 (= G242), S242 (≠ T266), R243 (= R267), A244 (≠ P268), Q256 (= Q280), V257 (= V281), G258 (= G282), T260 (= T284), G273 (= G297), I274 (= I298), S275 (= S299), A277 (= A301), Q279 (= Q303), H280 (= H304), N294 (= N318), K295 (≠ T319), D312 (= D336), V313 (≠ A337)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
43% identity, 90% coverage: 22:345/359 of query aligns to 11:329/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (= L139), R144 (= R159), I155 (= I170), G224 (= G240), R225 (≠ K241), G226 (= G242), S250 (≠ T266), R251 (= R267), A252 (≠ P268), Q264 (= Q280), V265 (= V281), G266 (= G282), Q267 (= Q283), S268 (≠ T284), G281 (= G297), I282 (= I298), S283 (= S299), S285 (≠ A301), Q287 (= Q303), H288 (= H304), N302 (= N318), K303 (≠ T319), D320 (= D336), A321 (= A337)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
39% identity, 90% coverage: 21:344/359 of query aligns to 10:327/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L139), T126 (= T140), R144 (= R159), I155 (= I170), R224 (≠ K241), G225 (= G242), T249 (= T266), R250 (= R267), Q263 (= Q280), I264 (≠ V281), G265 (= G282), L266 (≠ Q283), S267 (≠ T284), G280 (= G297), I281 (= I298), S282 (= S299), Q286 (= Q303), N301 (= N318), S302 (≠ T319), D303 (= D320), D319 (= D336), L320 (≠ A337)
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
50% identity, 34% coverage: 229:351/359 of query aligns to 193:315/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G240), R205 (≠ K241), S230 (≠ T266), R231 (= R267), A232 (≠ P268), Q244 (= Q280), V245 (= V281), G246 (= G282), T248 (= T284), G261 (= G297), I262 (= I298), S263 (= S299), A265 (= A301), Q267 (= Q303), H268 (= H304), N282 (= N318), K283 (≠ T319), D300 (= D336), L301 (≠ A337)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
50% identity, 34% coverage: 229:351/359 of query aligns to 211:333/333 of P13804
- R223 (≠ K241) binding
- S248 (≠ T266) binding
- R249 (= R267) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 281:284) binding
- T266 (= T284) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 299:304) binding
- N300 (= N318) binding
- DL 318:319 (≠ DA 336:337) binding
Sites not aligning to the query:
- 20:204 Domain I
- 116 G → R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- 171 T → I: decreased protein stability; dbSNP:rs1801591
- 205:333 Domain II
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
48% identity, 36% coverage: 218:345/359 of query aligns to 175:304/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G240), R200 (≠ K241), G201 (= G242), S225 (≠ T266), R226 (= R267), A227 (≠ P268), Q239 (= Q280), V240 (= V281), G241 (= G282), T243 (= T284), G256 (= G297), I257 (= I298), S258 (= S299), A260 (= A301), Q262 (= Q303), H263 (= H304), N277 (= N318), K278 (≠ T319), D295 (= D336), L296 (≠ A337)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
28% identity, 87% coverage: 35:348/359 of query aligns to 6:291/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G240), R184 (≠ K241), G185 (= G242), S209 (≠ T266), R210 (= R267), Q223 (= Q280), I224 (≠ V281), G225 (= G282), T227 (= T284), G240 (= G297), V241 (≠ I298), S242 (= S299), A244 (= A301), Q246 (= Q303), H247 (= H304), N261 (= N318), K262 (≠ T319), D279 (= D336), Y280 (≠ A337)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
29% identity, 88% coverage: 24:340/359 of query aligns to 4:311/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
28% identity, 88% coverage: 24:340/359 of query aligns to 3:310/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G240), R210 (≠ K241), G211 (= G242), S235 (≠ T266), A236 (≠ R267), P237 (= P268), Q249 (= Q280), V250 (= V281), G251 (= G282), Q252 (= Q283), S253 (≠ T284), G267 (= G297), I268 (= I298), S269 (= S299), S271 (≠ A301), Q273 (= Q303), H274 (= H304), N288 (= N318), T289 (= T319), D306 (= D336), I307 (≠ A337)
Query Sequence
>AZOBR_RS05475 FitnessBrowser__azobra:AZOBR_RS05475
MSEPSKPQGRKFQLPEHLKEYKGIWVIVEQERGSVHSVSWELVGEARKLADKLGVEVGAV
VLGADSPELNAICGDAFTYGADVVYKVTDPVLADYRTDPYTRVMTDVVNTYKPEIVLLGA
TTLGRDLAGAIATTLATGLTADCTELDIYMDNRSLAATRPTFGGTLLCTIQTLAYRPQMA
TVRPRVMSMPDRDDSRTGRVVEVFPNLRETDVITKVLSFIADREQTEAQLAFADIIVAAG
KGLGKPENLKLVFDLAKVLGGEVGVTRPLVQAGWTGFDRQVGQTGKTVRPKLYIAAGISG
AIQHRVGMEKSDLILAINTDPNAPIFDFAHLGLVGDALTILPALTDAFGKRLSVNRLAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory