Comparing AZOBR_RS05920 FitnessBrowser__azobra:AZOBR_RS05920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
34% identity, 96% coverage: 8:255/259 of query aligns to 9:260/261 of 2xuaH
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
33% identity, 95% coverage: 9:254/259 of query aligns to 14:267/274 of 4uhdA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
33% identity, 95% coverage: 9:254/259 of query aligns to 14:267/272 of 4uheA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
33% identity, 95% coverage: 9:254/259 of query aligns to 14:267/278 of 4uhfA
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 97% coverage: 9:258/259 of query aligns to 10:267/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 97% coverage: 9:258/259 of query aligns to 10:261/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 97% coverage: 9:258/259 of query aligns to 10:264/265 of 6eb3A
Q988D4 2-(acetamidomethylene)succinate hydrolase; alpha-(N-acetylaminomethylene)succinic acid amidohydrolase; AAMS amidohydrolase; EC 3.5.1.29 from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) (see paper)
30% identity, 95% coverage: 10:256/259 of query aligns to 22:278/278 of Q988D4
6aumA Crystal structure of human soluble epoxide hydrolase complexed with trans-4-[4-(3-trifluoromethoxyphenyl-l-ureido)-cyclohexyloxy]-benzoic acid. (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/547 of 6aumA
Sites not aligning to the query:
5fp0A Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/543 of 5fp0A
Sites not aligning to the query:
5am2A Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 238:363/537 of 5am2A
Sites not aligning to the query:
5am5A Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/546 of 5am5A
Sites not aligning to the query:
5am4A Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/546 of 5am4A
Sites not aligning to the query:
5am1A Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/546 of 5am1A
Sites not aligning to the query:
5am0A Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/546 of 5am0A
Sites not aligning to the query:
5alzA Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/546 of 5alzA
Sites not aligning to the query:
5alyA Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/546 of 5alyA
Sites not aligning to the query:
5alxA Ligand complex structure of soluble epoxide hydrolase (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 243:368/546 of 5alxA
Sites not aligning to the query:
8qn0A Soluble epoxide hydrolase in complex with rk3 (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 19:144/322 of 8qn0A
Sites not aligning to the query:
7p4kA Soluble epoxide hydrolase in complex with fl217 (see paper)
34% identity, 49% coverage: 3:128/259 of query aligns to 16:141/313 of 7p4kA
Sites not aligning to the query:
>AZOBR_RS05920 FitnessBrowser__azobra:AZOBR_RS05920
MFIRPRKTNIHIHVQGPQDGPPVLLLHSLGTNHHVWDPQAEVLARRFRVIRPDMRGHGLS
EAPPGPYGMEDLADDAFAVLDALGVGRCFVGGVSIGGMIAQTMALKAPHRVGGLVLVDTS
MATAVPAMWRERAGQVRASSVAPFADAITARWVTQGFADSPEMQGLRTMLHQTAAEGFAG
CAEALATADLSARVGDIAAPSLVIVGDQDQSTPVAAAQALCAALKGTLVVLPDAAHIPNL
EQPARLADTMLRFLSAQSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory