Comparing AZOBR_RS06620 FitnessBrowser__azobra:AZOBR_RS06620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
7x0rB Crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum (see paper)
35% identity, 89% coverage: 33:325/330 of query aligns to 8:294/313 of 7x0rB
Sites not aligning to the query:
P29724 Membrane lipoprotein TmpC; Membrane protein C; 35 kDa antigen; Lipoprotein TpN35; Purine nucleoside receptor A; PnrA from Treponema pallidum (strain Nichols) (see 2 papers)
35% identity, 97% coverage: 5:325/330 of query aligns to 14:344/353 of P29724
2fqyA Pnra from treponema pallidum complexed with adenosine. (see paper)
35% identity, 90% coverage: 28:325/330 of query aligns to 2:307/316 of 2fqyA
2fqxA Pnra from treponema pallidum complexed with guanosine (see paper)
35% identity, 90% coverage: 28:325/330 of query aligns to 2:307/316 of 2fqxA
2fqwA Pnra from treponema pallidum as purified from e. Coli (bound to inosine) (see paper)
35% identity, 90% coverage: 28:325/330 of query aligns to 2:307/316 of 2fqwA
6shuA Borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine (see paper)
31% identity, 78% coverage: 42:298/330 of query aligns to 17:276/316 of 6shuA
4pevA Crystal structure of abc transporter system solute-binding proteins from aeropyrum pernix k1
30% identity, 88% coverage: 33:323/330 of query aligns to 6:342/370 of 4pevA
6ya3A Crystal structure of pnra from s. Pneumoniae in complex with guanosine (see paper)
34% identity, 89% coverage: 32:325/330 of query aligns to 22:328/331 of 6ya3A
6yagA Crystal structure of pnra from s. Pneumoniae in complex with thymidine (see paper)
34% identity, 89% coverage: 32:325/330 of query aligns to 21:327/329 of 6yagA
6ya4A Crystal structure of pnra from s. Pneumoniae in complex with cytidine (see paper)
34% identity, 89% coverage: 32:325/330 of query aligns to 23:329/332 of 6ya4A
6y9uA Crystal structure of pnra from s. Pneumoniae in complex with adenosine (see paper)
34% identity, 89% coverage: 32:325/330 of query aligns to 23:329/332 of 6y9uA
6yabAAA Lipoprotein (see paper)
34% identity, 89% coverage: 32:325/330 of query aligns to 20:326/329 of 6yabAAA
3s99A Crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak
25% identity, 75% coverage: 76:323/330 of query aligns to 51:288/330 of 3s99A
Sites not aligning to the query:
6piiA The evolving story of atzt, a periplasmic binding protein (see paper)
24% identity, 77% coverage: 76:329/330 of query aligns to 55:297/336 of 6piiA
Sites not aligning to the query:
6pi6A The evolving story of atzt, a periplasmic binding protein (see paper)
24% identity, 77% coverage: 76:329/330 of query aligns to 52:294/333 of 6pi6A
Sites not aligning to the query:
6piiC The evolving story of atzt, a periplasmic binding protein (see paper)
24% identity, 77% coverage: 76:329/330 of query aligns to 52:294/331 of 6piiC
Sites not aligning to the query:
Q56328 ABC transporter riboflavin-binding protein RfuA; Membrane lipoprotein TpN38(b) from Treponema pallidum (strain Nichols) (see paper)
24% identity, 98% coverage: 1:325/330 of query aligns to 1:340/343 of Q56328
4iilA Crystal structure of rfua (tp0298) of t. Pallidum bound to riboflavin (see paper)
27% identity, 68% coverage: 101:325/330 of query aligns to 81:313/314 of 4iilA
Sites not aligning to the query:
>AZOBR_RS06620 FitnessBrowser__azobra:AZOBR_RS06620
MTRILAILALSLTAATVPAAGPALAADEFMPAVVFDQGGKFDKSFNEAAYNGAERFKKET
GIVYREFEVTSESQREQALRNMARRGATVITAVGFSQSAAVDKVSREYPNTKFCLIDDKL
DLPNVQSVTFKEHEGSFLVGMLAALASQSGKVGFIGGMDIPLIRNFLTGYEQGVKHVKAD
GEVFTNMTGTTPAAWNDPTRGAELAKSQFGRGADVVFAAAGATGLGVLQAAADAGKLGVG
VDSNQNWIHPGKILTSMVKRVDVTVYDCMKSAKDGSWTAGHRVVGLKEEGVGYALDENNR
KLVTAEMEKAVEDAKRKIIAGELAVKPYQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory