SitesBLAST
Comparing AZOBR_RS07885 FitnessBrowser__azobra:AZOBR_RS07885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q51330 Oxalate:formate antiporter; OFA; Oxalate:formate antiport protein; Oxalate:formate exchange protein from Oxalobacter formigenes (see 4 papers)
36% identity, 99% coverage: 1:430/433 of query aligns to 1:413/418 of Q51330
- M1 (= M1) modified: Initiator methionine, Removed
- C28 (≠ S28) mutation to G: Slight decrease in activity; when associated with A-271.
- Q56 (= Q56) mutation to C: Residual activity.
- F59 (= F59) mutation to C: Loss of activity.
- Q66 (≠ E66) mutation to C: Residual activity.
- S69 (≠ L69) mutation to C: Residual activity.
- C271 (≠ T285) mutation to A: Slight decrease in activity; when associated with G-28.
- G349 (= G362) mutation to C: Loss of activity.
- K355 (= K368) mutation K->C,G,Q,T: Loss of activity.; mutation to R: Residual activity.
- G362 (≠ V375) mutation to C: Residual activity.
- G363 (≠ P376) mutation to C: Residual activity.
8hpkA Crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form (see paper)
37% identity, 93% coverage: 11:413/433 of query aligns to 1:385/390 of 8hpkA
6zguA Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
30% identity, 94% coverage: 16:420/433 of query aligns to 4:398/404 of 6zguA
6zgtA Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
30% identity, 94% coverage: 16:420/433 of query aligns to 4:398/404 of 6zgtA
6zgsA Crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution
30% identity, 94% coverage: 16:420/433 of query aligns to 4:398/404 of 6zgsA
A0LNN5 L-lactate transporter; SfMCT from Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) (see paper)
29% identity, 93% coverage: 16:417/433 of query aligns to 10:411/412 of A0LNN5
- L28 (≠ Q34) mutation to A: Loss of transport activity.
- Y119 (= Y124) binding ; mutation Y->A,F: Loss of transport activity.
- L145 (≠ F150) mutation to A: Strong decrease in transport activity.
- H250 (≠ Q246) mutation to A: Strong decrease in transport activity.; mutation to F: Loss of transport activity.
- R256 (≠ K252) mutation to A: No change in transport activity.; mutation to D: Increases transport activity.
- D257 (= D253) mutation to A: Loss of transport activity.
- N276 (= N282) mutation to A: Loss of transport activity.
- R280 (= R286) binding ; mutation to A: Abolishes L-lactate binding and L-lactate transport.
- Y331 (≠ W337) mutation to A: Loss of transport activity.; mutation to F: No change in transport activity.
- F335 (≠ Y341) mutation to A: Increases transport activity.
- F359 (≠ Y365) mutation to A: Loss of transport activity.
- C362 (≠ K368) mutation to A: Decrease in transport activity.
- K377 (≠ A383) mutation K->A,D: No change in transport activity.
- D378 (vs. gap) mutation to A: Loss of transport activity.
- Y383 (≠ W388) mutation to A: Loss of transport activity.; mutation to F: Strong decrease in transport activity.
6zgrA Crystal structure of a mfs transporter with bound 1- hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution
30% identity, 94% coverage: 16:420/433 of query aligns to 4:393/399 of 6zgrA
6g9xA Crystal structure of a mfs transporter at 2.54 angstroem resolution (see paper)
30% identity, 94% coverage: 16:420/433 of query aligns to 4:390/396 of 6g9xA
6zguB Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
31% identity, 88% coverage: 33:412/433 of query aligns to 15:364/364 of 6zguB
6zgtB Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
31% identity, 88% coverage: 33:412/433 of query aligns to 15:364/364 of 6zgtB
6zgsB Crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution
31% identity, 88% coverage: 33:412/433 of query aligns to 15:364/364 of 6zgsB
6g9xB Crystal structure of a mfs transporter at 2.54 angstroem resolution (see paper)
30% identity, 89% coverage: 33:416/433 of query aligns to 17:368/368 of 6g9xB
6zgrB Crystal structure of a mfs transporter with bound 1- hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution
30% identity, 88% coverage: 33:412/433 of query aligns to 17:363/364 of 6zgrB
O60669 Monocarboxylate transporter 2; MCT 2; Solute carrier family 16 member 7 from Homo sapiens (Human) (see paper)
24% identity, 82% coverage: 71:426/433 of query aligns to 74:453/478 of O60669
- R143 (= R139) mutation to A: Reduces pyruvate transmembrane transporter activity. Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization. Dominant negative mutant.
- N147 (≠ A143) mutation to A: Reduces pyruvate transmembrane transporter activity. Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization.
- F262 (≠ L241) mutation to A: No effect on protein abundance. Does not affect cell surface localization.
- D293 (≠ N282) May be protonated during monocarboxylate transport; mutation to N: Reduced proton-dependent active symport, but not pyruvate transport.
- R297 (= R286) mutation R->L,D: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization.
- N305 (vs. gap) mutation to A: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization.
- F351 (= F334) mutation to A: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization.
- S355 (≠ Y341) mutation S->G,A: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization.
- E360 (≠ A346) mutation to A: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization.
- T445 (≠ I418) to S: in dbSNP:rs3763980
Sites not aligning to the query:
- 18 W→A: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization. Dominant negative mutant.
- 20 W→A: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization. Dominant negative mutant.
- 34 Y→F: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization.
- 38 K→D: Reduces pyruvate transmembrane transporter activity. No effect on protein abundance. Does not affect cell surface localization.
- 70 Y→A: No effect on protein abundance. Does not affect cell surface localization.
Query Sequence
>AZOBR_RS07885 FitnessBrowser__azobra:AZOBR_RS07885
MHQALTEAPKGPLGGRWFQLVIGVICMSMIANLQYGWTLFVEPIDQKHGWGRAAIQVAFT
IFVVMETWLVPVEGWFVDKFGPRIVVLIGGVLCAAAWAVNSVADSLAMLYLGAALGGIGA
GGVYGTCVGNALKWFPDRRGLAAGLTAAGFGAGSALTVVPIANMIHSSGYEATFMTFGIG
QGAVILALAWFLASPKKGQVPEVTRSAVSQTRESYTPVQMLKTPVFWVMYAMFVMVAAGG
LMATAQLGPIAKDFHLDGVPVSIMGLTLPALTFALSIDRVLNGVTRPFFGWVSDHIGREN
TMFIAFALECVGILALNQWGHNPVAFVILTGLVFFAWGEIYSLFPALCGDSFGSKFATTN
AGLLYTAKGTASLVVPFANVAVASTGSWQAVFFFAAAVNGIAALLAIFVLKPMRARQINE
SLPASKLAAEPAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory