Comparing AZOBR_RS08245 FitnessBrowser__azobra:AZOBR_RS08245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 89% coverage: 8:269/294 of query aligns to 1:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 89% coverage: 8:268/294 of query aligns to 1:253/253 of 1g9xB
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
30% identity, 84% coverage: 11:257/294 of query aligns to 4:224/285 of 4yerA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
27% identity, 88% coverage: 11:270/294 of query aligns to 2:237/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 83% coverage: 11:253/294 of query aligns to 1:220/240 of 4ymuJ
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 88% coverage: 12:270/294 of query aligns to 3:237/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 88% coverage: 12:270/294 of query aligns to 3:237/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 88% coverage: 12:270/294 of query aligns to 4:238/241 of 6mbnA
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 85% coverage: 11:260/294 of query aligns to 1:219/348 of 3d31A
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 87% coverage: 12:268/294 of query aligns to 3:235/235 of 6mhzA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
26% identity, 91% coverage: 20:287/294 of query aligns to 35:287/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
26% identity, 91% coverage: 20:287/294 of query aligns to 35:287/382 of 7aheC
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
29% identity, 84% coverage: 8:253/294 of query aligns to 1:225/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
29% identity, 84% coverage: 8:253/294 of query aligns to 1:225/263 of 7d08B
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 87% coverage: 12:267/294 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 87% coverage: 12:267/294 of query aligns to 3:234/234 of 4p31A
7ahdC Opua (e190q) occluded (see paper)
27% identity, 82% coverage: 22:261/294 of query aligns to 37:255/260 of 7ahdC
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
29% identity, 83% coverage: 11:253/294 of query aligns to 2:223/253 of 6z5uK
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 91% coverage: 1:269/294 of query aligns to 7:250/378 of P69874
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 87% coverage: 12:266/294 of query aligns to 3:233/233 of 6b8bA
>AZOBR_RS08245 FitnessBrowser__azobra:AZOBR_RS08245
MTTQSMTTTPLLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGF
YTPTVGRLTLRHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNK
LIRASGFSIAGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIA
RAMCTEPVMLCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVV
VLDYGRKISDGDPAFVKNDPAVIRAYLGEEEDEELPPEIKADLPEVAKRAEEGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory