Comparing AZOBR_RS08655 FitnessBrowser__azobra:AZOBR_RS08655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
62% identity, 93% coverage: 26:340/340 of query aligns to 7:324/324 of 4z9nB
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
32% identity, 62% coverage: 26:237/340 of query aligns to 6:208/251 of 1xt8B
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 62% coverage: 26:235/340 of query aligns to 2:200/229 of 5t0wA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
30% identity, 62% coverage: 33:242/340 of query aligns to 3:204/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 62% coverage: 33:242/340 of query aligns to 3:202/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
28% identity, 64% coverage: 27:242/340 of query aligns to 3:206/229 of 6svfA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
26% identity, 73% coverage: 23:271/340 of query aligns to 5:249/278 of 2ia4B
2vhaA Debp (see paper)
26% identity, 73% coverage: 23:271/340 of query aligns to 4:248/276 of 2vhaA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
25% identity, 73% coverage: 27:273/340 of query aligns to 3:222/231 of 2v25A
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
29% identity, 60% coverage: 19:221/340 of query aligns to 36:230/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
29% identity, 60% coverage: 19:221/340 of query aligns to 36:230/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
29% identity, 60% coverage: 19:221/340 of query aligns to 37:231/288 of 6h2tA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
26% identity, 73% coverage: 23:271/340 of query aligns to 2:246/503 of 8ovoA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
28% identity, 65% coverage: 26:245/340 of query aligns to 3:210/247 of 2yjpA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
26% identity, 64% coverage: 27:242/340 of query aligns to 6:213/243 of 5eyfB
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
26% identity, 70% coverage: 33:269/340 of query aligns to 3:230/234 of 3k4uE
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
27% identity, 34% coverage: 27:142/340 of query aligns to 2:111/130 of 7a99B
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
24% identity, 66% coverage: 26:251/340 of query aligns to 9:222/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
24% identity, 66% coverage: 26:251/340 of query aligns to 9:222/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
24% identity, 66% coverage: 26:251/340 of query aligns to 9:222/241 of 3vvdA
>AZOBR_RS08655 FitnessBrowser__azobra:AZOBR_RS08655
MKSGILAAAAAAVVFGAVTGAQAGPTLDAVKGRGFVQCGVNAGLPGFGNPDSSGNWTGLD
VDYCRAVAVALFNDPNKVKFTPLSAQQRFPAIQSGEVDLLSRNTTVTLTRDTSVGLNFAP
VTYYDGQGFMVNKKLGVKSAKELNGATVCVQAGTTTELNLADYFRTNNMSYNPVVIESND
EVNAAYFAGRCDVLTTDASGLAGTRAGVAPVPDDHIILPEIISKEPLAPAVRHGDDQWFD
VVKWTVYATIQAEEMGITSKNVDEFVNSKNPEIQRILGTSPGMGKALGLDEKWAYNIIKT
MGNYGEIFERNVGTKTPLKLERGLNALWTNGGLQYAMPIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory