SitesBLAST
Comparing AZOBR_RS11740 FitnessBrowser__azobra:AZOBR_RS11740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
29% identity, 68% coverage: 27:286/383 of query aligns to 17:250/332 of 2glxA
- active site: K93 (= K113), H179 (= H204)
- binding acetate ion: K93 (= K113), H179 (= H204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S32 (≠ G52), T33 (≠ R53), R37 (≠ K57), S69 (≠ A89), T70 (≠ G90), N72 (≠ T92), H75 (≠ R95), E92 (= E112), K93 (= K113), H121 (≠ F144), W161 (= W187), R162 (≠ N188)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
29% identity, 68% coverage: 27:286/383 of query aligns to 18:251/333 of Q2I8V6
- S33 (≠ G52) mutation to D: No activity.
- ST 33:34 (≠ GR 52:53) binding
- R38 (≠ K57) binding
- TTNELH 71:76 (≠ GTTQMR 90:95) binding
- EK 93:94 (= EK 112:113) binding
- K94 (= K113) mutation to G: Less than 1% remaining activity.
- N120 (≠ K142) binding
- WR 162:163 (≠ WN 187:188) binding
- D176 (= D200) mutation to A: Less than 1% remaining activity.
- H180 (= H204) mutation to A: Less than 2% remaining activity.
- G206 (= G235) mutation to I: No effect.
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 283 binding
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
28% identity, 68% coverage: 27:286/383 of query aligns to 18:251/333 of 4koaA
Sites not aligning to the query:
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
22% identity, 87% coverage: 49:383/383 of query aligns to 38:378/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: E41 (≠ G52), T79 (≠ G90), P80 (≠ T91), N81 (≠ T92), H84 (≠ R95), E101 (= E112), K102 (= K113), W173 (= W187), R174 (≠ N188)
- binding alpha-L-sorbopyranose: K102 (= K113), Y131 (≠ K142), Y159 (≠ F175), Q161 (≠ G177), W163 (= W179), R174 (≠ N188), D187 (= D200)
Sites not aligning to the query:
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
22% identity, 87% coverage: 49:383/383 of query aligns to 40:390/390 of F0M433
- E43 (≠ G52) binding
- T81 (≠ G90) binding
- N83 (≠ T92) binding
- H86 (≠ R95) binding
- E103 (= E112) binding
- K104 (= K113) binding ; binding
- A130 (≠ V139) binding
- N132 (≠ D141) binding
- Y133 (≠ K142) binding
- Q163 (≠ G177) binding
- W175 (= W187) binding
- R176 (≠ N188) binding ; binding
- D189 (= D200) binding
- H193 (= H204) binding
- Y335 (≠ D329) binding
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
22% identity, 87% coverage: 49:381/383 of query aligns to 39:372/372 of 6a3iA
- binding Levoglucosan: K103 (= K113), Y132 (≠ K142), Y160 (≠ F175), Q162 (≠ G177), R175 (≠ N188), D188 (= D200), H192 (= H204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: E42 (≠ G52), A43 (≠ R53), P81 (≠ T91), N82 (≠ T92), L84 (≠ M94), H85 (≠ R95), E102 (= E112), K103 (= K113), W174 (= W187), R175 (≠ N188)
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
23% identity, 86% coverage: 5:335/383 of query aligns to 5:300/325 of 1zh8A
- active site: K98 (= K113), H187 (= H204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (≠ M10), C11 (≠ H11), G12 (= G12), I13 (≠ V13), A14 (≠ T14), S37 (≠ G52), R38 (= R53), T39 (≠ N54), H42 (≠ K57), T74 (≠ I85), L75 (≠ F86), P76 (≠ T91), L79 (≠ M94), E97 (= E112), K98 (= K113), N126 (≠ D141), Y165 (≠ A182), W170 (= W187), R171 (≠ N188), H187 (= H204), Y276 (≠ D308)
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
22% identity, 77% coverage: 50:345/383 of query aligns to 33:293/331 of 2poqX
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
22% identity, 77% coverage: 50:345/383 of query aligns to 33:293/331 of 2o4uX
- binding phosphate ion: A35 (≠ G52), R36 (= R53), R40 (≠ K57), Y57 (≠ L74), N101 (= N118), A103 (≠ E120), D145 (≠ K162), R147 (≠ L164), K155 (≠ Y172), Q232 (≠ R267), S234 (≠ Y269), T236 (= T275), Q247 (≠ G299), N250 (≠ R302), W253 (= W305), R292 (≠ V344)
Sites not aligning to the query:
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
22% identity, 77% coverage: 50:345/383 of query aligns to 34:294/334 of Q7JK39
- H79 (≠ R95) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (≠ H204) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
22% identity, 77% coverage: 50:345/383 of query aligns to 34:294/334 of Q9TQS6
- R148 (≠ L164) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
- R202 (≠ K236) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 51% coverage: 72:266/383 of query aligns to 54:235/322 of 3q2kK
- active site: K95 (= K113), H183 (= H204)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K95 (= K113), T155 (≠ V174), R156 (≠ F175), Y160 (≠ W179), N179 (≠ D200), Q180 (≠ M201), H183 (= H204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T72 (≠ G90), P73 (≠ T91), S74 (≠ T92), L76 (≠ M94), H77 (≠ R95), E94 (= E112), K95 (= K113), Q123 (≠ D141), W166 (= W187), R167 (≠ N188), H183 (= H204)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 12, 239
- binding 1,4-dihydronicotinamide adenine dinucleotide: 9, 11, 12, 13, 35, 36
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 51% coverage: 73:266/383 of query aligns to 60:240/347 of 3q2kC
- active site: K100 (= K113), H188 (= H204)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K100 (= K113), W159 (= W173), T160 (≠ V174), R161 (≠ F175), Y165 (≠ W179), N184 (≠ D200), Q185 (≠ M201), H188 (= H204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A76 (= A89), T77 (≠ G90), S79 (≠ T92), H82 (≠ R95), Q85 (≠ L98), E99 (= E112), K100 (= K113), Q128 (≠ D141), W171 (= W187), R172 (≠ N188)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 17, 243, 244
- binding 1,4-dihydronicotinamide adenine dinucleotide: 16, 17, 18, 40, 41
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
28% identity, 41% coverage: 102:258/383 of query aligns to 80:225/355 of 6o15A
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
25% identity, 83% coverage: 59:374/383 of query aligns to 40:332/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F152 (= F170), N154 (≠ Y172), D175 (= D200), L176 (≠ M201), H179 (= H204), E236 (≠ D272), W271 (= W305)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T70 (≠ A89), T71 (≠ G90), P72 (≠ T91), N73 (≠ T92), L75 (≠ M94), H76 (≠ R95), Q79 (≠ L98), E93 (= E112), K94 (= K113), N122 (vs. gap), W161 (= W179), H179 (= H204), Y290 (≠ F332)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 11
- binding 1,4-dihydronicotinamide adenine dinucleotide: 10, 11, 12, 33, 34
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
25% identity, 83% coverage: 59:374/383 of query aligns to 40:332/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: N154 (≠ Y172), D175 (= D200), H179 (= H204), E236 (≠ D272), W271 (= W305)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T70 (≠ A89), T71 (≠ G90), P72 (≠ T91), N73 (≠ T92), L75 (≠ M94), H76 (≠ R95), Q79 (≠ L98), E93 (= E112), K94 (= K113), N122 (vs. gap), W161 (= W179), Y290 (≠ F332)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 11
- binding 1,4-dihydronicotinamide adenine dinucleotide: 8, 10, 11, 12, 33, 34
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
25% identity, 83% coverage: 59:374/383 of query aligns to 40:332/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: T70 (≠ A89), T71 (≠ G90), P72 (≠ T91), N73 (≠ T92), L75 (≠ M94), H76 (≠ R95), Q79 (≠ L98), E93 (= E112), K94 (= K113), N122 (vs. gap), W161 (= W179), H179 (= H204), Y290 (≠ F332)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
22% identity, 86% coverage: 50:378/383 of query aligns to 34:336/336 of 5a06A
- active site: K101 (= K113), Y186 (≠ H204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (≠ G52), G37 (≠ R53), T38 (≠ N54), K41 (= K57), Y59 (vs. gap), I77 (≠ A89), T78 (≠ G90), P79 (≠ T91), N80 (≠ T92), L82 (≠ M94), H83 (≠ R95), E100 (= E112), K101 (= K113), R129 (≠ Q140), W168 (= W187), R169 (≠ N188), Y186 (≠ H204), Y264 (≠ L289)
- binding sorbitol: D72 (≠ T84), H96 (= H108), K101 (= K113), R122 (≠ V134), R122 (≠ V134), L124 (≠ N136), F160 (≠ Y172), R169 (≠ N188), D182 (= D200), Y186 (≠ H204), K287 (≠ D324), H296 (≠ S338), E299 (≠ R341), E306 (≠ P348), G310 (= G352), G311 (≠ L353)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
22% identity, 86% coverage: 50:378/383 of query aligns to 34:336/336 of 5a03C
- active site: K101 (= K113), Y186 (≠ H204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (≠ G52), G37 (≠ R53), T38 (≠ N54), K41 (= K57), Y59 (vs. gap), I77 (≠ A89), T78 (≠ G90), P79 (≠ T91), N80 (≠ T92), L82 (≠ M94), H83 (≠ R95), E100 (= E112), K101 (= K113), R129 (≠ Q140), W168 (= W187), R169 (≠ N188), Y186 (≠ H204), Y264 (≠ L289)
- binding beta-D-xylopyranose: K101 (= K113), F160 (≠ Y172), R169 (≠ N188), D182 (= D200), Y186 (≠ H204)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
22% identity, 86% coverage: 50:378/383 of query aligns to 33:335/335 of 5a05A
- active site: K100 (= K113), Y185 (≠ H204)
- binding beta-D-glucopyranose: K100 (= K113), F159 (≠ Y172), D181 (= D200), Y185 (≠ H204)
- binding alpha-D-glucopyranose: P259 (≠ A285), S262 (≠ G288)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (≠ G52), G36 (≠ R53), T37 (≠ N54), K40 (= K57), Y58 (vs. gap), I76 (≠ A89), T77 (≠ G90), P78 (≠ T91), N79 (≠ T92), L81 (≠ M94), H82 (≠ R95), E99 (= E112), K100 (= K113), R128 (≠ Q140), W167 (= W187), R168 (≠ N188), Y185 (≠ H204), Y263 (≠ L289)
Sites not aligning to the query:
Query Sequence
>AZOBR_RS11740 FitnessBrowser__azobra:AZOBR_RS11740
MSTKRLGIIMHGVTGRMGMNQHLIRSILAIRAQGGVTLSDGSRVMPDPILVGRNAEKIRE
LAQRHGVERWTDNLDTALANPDDTIFFDAGTTQMRPTLLEAAIRAGKHVYCEKPIATNLE
EALRVVRLAEEAGVKNGTVQDKLFLPGLQKLKMLRDSGFFGKILSVRGEFGYWVFEGDWQ
PAQRPSWNYREEDGGGIILDMVCHWRYVLDNLFGQVKSVSCLGAIHIPERWDEQGKRYQA
TADDAAYATFELEGGVIAHINSSWATRVYRDDLVTFQVDGTHGSAVAGLSDCVIQPRQGT
PRPVWNPDQKQTMDFYATWQPVPDNQPTDNGFKTQWESFIRHVVEDAPFDHGLIEGAKGV
QLVEAALKSWKERRWVDVPSLTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory