SitesBLAST
Comparing AZOBR_RS16025 FitnessBrowser__azobra:AZOBR_RS16025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
36% identity, 79% coverage: 67:394/413 of query aligns to 3:312/339 of 6cgqA
- active site: K56 (= K121), T80 (≠ N145), E206 (≠ Q280), S210 (≠ C284), A228 (≠ G310), T305 (≠ C387)
- binding pyridoxal-5'-phosphate: F55 (= F120), K56 (= K121), N82 (= N147), V175 (≠ T247), G176 (= G248), N177 (≠ G249), A178 (≠ G250), G179 (≠ T251), N180 (≠ G252), A228 (≠ G310), E275 (≠ C357), T305 (≠ C387), G306 (≠ A388)
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
36% identity, 79% coverage: 70:394/413 of query aligns to 19:333/360 of P9WG59
- K69 (= K121) modified: N6-(pyridoxal phosphate)lysine
- N95 (= N147) binding
- K151 (≠ E202) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ GGGTG 248:252) binding
- T326 (≠ C387) binding
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
36% identity, 79% coverage: 67:394/413 of query aligns to 5:320/345 of 6cgqB
- active site: K58 (= K121), T82 (≠ N145), E214 (≠ Q280), S218 (≠ C284), A236 (≠ G310), T313 (≠ C387)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K121), S81 (≠ T144), T82 (≠ N145), N84 (= N147), T85 (≠ A148), V183 (≠ T247), G184 (= G248), N185 (≠ G249), A186 (≠ G250), N188 (≠ G252), A236 (≠ G310), I237 (= I311), E283 (≠ C357), T313 (≠ C387)
- binding phosphate ion: K58 (= K121), T85 (≠ A148), N151 (≠ S213), S152 (≠ T214), R157 (= R220), N185 (≠ G249)
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
36% identity, 79% coverage: 67:394/413 of query aligns to 7:322/350 of 6nmxA
- active site: K60 (= K121), T84 (≠ N145), E216 (≠ Q280), S220 (≠ C284), A238 (≠ G310), T315 (≠ C387)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K121), S83 (≠ T144), T84 (≠ N145), N86 (= N147), T87 (≠ A148), F133 (≠ I193), N153 (≠ S213), S154 (≠ T214), R159 (= R220), V185 (≠ T247), G186 (= G248), N187 (≠ G249), A188 (≠ G250), G189 (≠ T251), N190 (≠ G252), A238 (≠ G310), I239 (= I311), E285 (≠ C357), T315 (≠ C387)
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
36% identity, 79% coverage: 70:394/413 of query aligns to 10:324/349 of 2d1fA
- active site: K60 (= K121), T84 (≠ N145), D209 (≠ S271), R213 (= R275), L215 (≠ V277), A240 (≠ G310), T317 (≠ C387)
- binding pyridoxal-5'-phosphate: F59 (= F120), K60 (= K121), N86 (= N147), V186 (≠ T247), G187 (= G248), N188 (≠ G249), A189 (≠ G250), G190 (≠ T251), N191 (≠ G252), A240 (≠ G310), T317 (≠ C387)
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 79% coverage: 70:394/413 of query aligns to 19:333/360 of A0R220
- K151 (≠ E202) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
36% identity, 80% coverage: 63:394/413 of query aligns to 2:324/351 of 3aexA
- active site: K61 (= K121), T85 (≠ N145), P212 (= P274), G216 (≠ A278), Q218 (= Q280), A240 (≠ G310), T317 (≠ C387)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K121), S84 (≠ T144), T85 (≠ N145), N87 (= N147), T88 (≠ A148), V186 (≠ T247), G187 (= G248), N188 (≠ G249), A189 (≠ G250), G190 (≠ T251), N191 (≠ G252), A240 (≠ G310), I241 (= I311), E287 (≠ C357), T317 (≠ C387)
- binding phosphate ion: K61 (= K121), T88 (≠ A148), N154 (≠ K216), S155 (vs. gap), R160 (= R220), N188 (≠ G249)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
36% identity, 80% coverage: 63:394/413 of query aligns to 2:324/351 of 1v7cA
- active site: K61 (= K121), T85 (≠ N145), P212 (= P274), G216 (≠ A278), Q218 (= Q280), A240 (≠ G310), T317 (≠ C387)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K121), S84 (≠ T144), T85 (≠ N145), N87 (= N147), T88 (≠ A148), F134 (≠ I193), N154 (≠ K216), S155 (vs. gap), R160 (= R220), V186 (≠ T247), G187 (= G248), N188 (≠ G249), A189 (≠ G250), G190 (≠ T251), N191 (≠ G252), A240 (≠ G310), I241 (= I311), E287 (≠ C357), T317 (≠ C387)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
36% identity, 80% coverage: 63:394/413 of query aligns to 1:323/350 of 3aeyA
- active site: K60 (= K121), T84 (≠ N145), P211 (= P274), G215 (≠ A278), Q217 (= Q280), A239 (≠ G310), T316 (≠ C387)
- binding sulfate ion: K60 (= K121), K60 (= K121), G85 (= G146), N86 (= N147), T87 (≠ A148), T87 (≠ A148), S154 (vs. gap), R159 (= R220), N187 (≠ G249), R228 (= R289), V230 (≠ Y291), E231 (= E292), R232 (≠ A293), A239 (≠ G310)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
36% identity, 80% coverage: 63:394/413 of query aligns to 2:324/350 of 1uimA
- active site: K61 (= K121), T85 (≠ N145), P212 (= P274), G216 (≠ A278), Q218 (= Q280), A240 (≠ G310), T317 (≠ C387)
- binding pyridoxal-5'-phosphate: F60 (= F120), K61 (= K121), N87 (= N147), G187 (= G248), N188 (≠ G249), A189 (≠ G250), G190 (≠ T251), N191 (≠ G252), A240 (≠ G310), E287 (≠ C357), T317 (≠ C387), G318 (≠ A388)
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
27% identity, 93% coverage: 23:406/413 of query aligns to 17:412/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F120), K128 (= K121), D159 (≠ N147), G259 (≠ T247), G260 (= G248), N261 (≠ G249), L262 (≠ G250), G263 (≠ T251), N264 (≠ G252), A321 (≠ G310), H369 (≠ E359), T397 (≠ C387)
- binding s-adenosylmethionine: S64 (vs. gap), T65 (vs. gap), W66 (vs. gap), P67 (vs. gap), G69 (vs. gap), S90 (= S84), F92 (≠ G86), N97 (≠ P91), L98 (= L92), W100 (≠ A94), W115 (≠ L108), W115 (≠ L108), Q246 (= Q234), F247 (≠ L235)
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 90% coverage: 23:393/413 of query aligns to 92:478/526 of Q9S7B5
- N172 (≠ P91) binding
- L173 (= L92) binding
- K181 (≠ A100) binding in monomer B; binding in monomer A
- N187 (≠ A105) binding in monomer B
- L205 (≠ R123) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
34% identity, 79% coverage: 69:394/413 of query aligns to 8:324/350 of 2zsjA
- active site: K61 (= K121), T85 (≠ N145), Q218 (= Q280), A222 (≠ C284), A240 (≠ G310), T317 (≠ C387)
- binding pyridoxal-5'-phosphate: F60 (= F120), K61 (= K121), N87 (= N147), V186 (≠ T247), G187 (= G248), N188 (≠ G249), A189 (≠ G250), G190 (≠ T251), N191 (≠ G252), A240 (≠ G310), T317 (≠ C387), G318 (≠ A388)
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
26% identity, 93% coverage: 23:406/413 of query aligns to 35:414/448 of 2c2gA
Q8VBT2 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Mus musculus (Mouse)
33% identity, 33% coverage: 100:235/413 of query aligns to 20:156/327 of Q8VBT2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
1pwhA Rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate (see paper)
32% identity, 33% coverage: 100:235/413 of query aligns to 20:156/327 of 1pwhA
Sites not aligning to the query:
- active site: 194, 198, 200, 222, 269, 303
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-o-methyl-l-serine: 168, 169, 170, 171, 222, 224, 303, 304
8y1jA Structure of the pyridoxal 5'-phosphate-dependent (plp) threonine deaminase ilva1 from pseudomonas aeruginosa pao1 (see paper)
30% identity, 53% coverage: 67:283/413 of query aligns to 1:216/502 of 8y1jA
Sites not aligning to the query:
P20132 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Homo sapiens (Human) (see paper)
28% identity, 66% coverage: 100:371/413 of query aligns to 20:282/328 of P20132
Sites not aligning to the query:
- 303 C→A: Loss of enzyme activity.
P09367 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Rattus norvegicus (Rat) (see paper)
27% identity, 33% coverage: 100:235/413 of query aligns to 20:192/363 of P09367
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
25% identity, 70% coverage: 90:380/413 of query aligns to 51:362/383 of 5vm5D
- active site: K82 (= K121), E104 (≠ P143)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (≠ F120), K82 (= K121), T105 (= T144), G106 (≠ N145), A107 (vs. gap), Q109 (≠ N147), H110 (≠ A148), S185 (vs. gap), G227 (= G248), G229 (= G250), S230 (≠ T251), N231 (≠ G252), G296 (= G310), E343 (= E359)
Sites not aligning to the query:
Query Sequence
>AZOBR_RS16025 FitnessBrowser__azobra:AZOBR_RS16025
VPFDSNLTTERPTFVTHLECAYTGERYEADTVHNLSKAGKPLLVRYDLEGVRGALTKDAL
AERPQDLWRYRELLPVRRVQDIVSLGEAVTPLVALPKLAAKLGAAELLVKDEGRLPTGSF
KARGLVMAVSMAKAFGIKHMAMPTNGNAGAALAAYATRAGIKTTIFCPEDTPEVNVSEIE
LQGATVYRVNGLIDDCGKIVGEGKAKAGWFDVSTLKEPYRIEGKKTMGLELAEQLGWEVP
DVIFYPTGGGTGLIGMWKAFAELEAIGFIGSKRPRMVAVQAAGCAPMVRAYEAGEEHAPR
WPDAHTIASGIRVPQAVGDFLILRAVRESGGFAVAVPDEAIQAALDEAAREEGFLLCPEG
AATYAAYKQALGDGRVGRDERAVLFNCATGLKYPLPPVHRTLDRHQPIDYSVF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory