SitesBLAST
Comparing AZOBR_RS17545 FitnessBrowser__azobra:AZOBR_RS17545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4kemA Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
88% identity, 100% coverage: 1:389/390 of query aligns to 1:389/390 of 4kemA
- active site: N53 (= N53), A152 (= A152), K181 (= K181), K183 (= K183), V211 (= V211), D212 (= D212), A213 (= A213), N214 (= N214), E238 (= E238), G263 (= G263), E264 (= E264), D284 (= D284), Q289 (= Q289), D291 (= D291), R316 (= R316), H321 (= H321), E340 (= E340), K347 (= K347)
- binding magnesium ion: D212 (= D212), E238 (= E238), E264 (= E264)
Q89FH0 D(-)-tartrate dehydratase; EC 4.2.1.81 from Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) (see paper)
69% identity, 99% coverage: 1:388/390 of query aligns to 3:389/389 of Q89FH0
- K102 (= K100) mutation K->A,M: Loss of dehydration activity.
- K184 (= K183) active site, acceptor; mutation to A: Loss of dehydration activity.; mutation to R: Reduced dehydration activity.
- D213 (= D212) binding
- E239 (= E238) binding
- E265 (= E264) binding
- H322 (= H321) active site, Proton donor/acceptor; mutation to N: Decreased but measurable dehydration activity.
2dw6A Crystal structure of the mutant k184a of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and d-tartrate (see paper)
69% identity, 99% coverage: 1:388/390 of query aligns to 2:388/388 of 2dw6A
- active site: N54 (= N53), K181 (= K181), A183 (≠ K183), D212 (= D212), N214 (= N214), E238 (= E238), E264 (= E264), D291 (= D291), H321 (= H321), E340 (= E340), D344 (= D344)
- binding magnesium ion: D212 (= D212), E238 (= E238), E264 (= E264)
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 89% coverage: 26:373/390 of query aligns to 54:378/398 of Q8ZL58
- KR 82:83 (≠ GR 54:55) binding
- K195 (= K181) binding
- K197 (= K183) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D212) binding
- N228 (= N214) binding
- E252 (= E238) binding
- E278 (= E264) binding
- H328 (= H321) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (≠ S341) binding
Sites not aligning to the query:
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
30% identity, 89% coverage: 26:373/390 of query aligns to 51:375/395 of 2pp1A
- active site: S78 (≠ N53), K192 (= K181), K194 (= K183), D223 (= D212), N225 (= N214), E249 (= E238), G274 (= G263), E275 (= E264), D298 (= D291), H325 (= H321), E345 (≠ S341)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: K79 (≠ G54), F168 (≠ Y156), K194 (= K183), E275 (= E264), H325 (= H321), E345 (≠ S341)
- binding magnesium ion: D223 (= D212), E249 (= E238), E275 (= E264)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
30% identity, 89% coverage: 26:373/390 of query aligns to 51:375/395 of 2pp3A
- active site: S78 (≠ N53), K192 (= K181), A194 (≠ K183), D223 (= D212), N225 (= N214), E249 (= E238), G274 (= G263), E275 (= E264), D298 (= D291), H325 (= H321), E345 (≠ S341)
- binding l-glucaric acid: K79 (≠ G54), K192 (= K181), D223 (= D212), N225 (= N214), E275 (= E264), H325 (= H321), E345 (≠ S341), F347 (≠ P343)
- binding magnesium ion: D223 (= D212), E249 (= E238), E275 (= E264)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
28% identity, 95% coverage: 17:385/390 of query aligns to 10:355/363 of 2og9A
- active site: S46 (≠ N53), T132 (≠ A151), K160 (= K181), K162 (= K183), D191 (= D212), N193 (= N214), E217 (= E238), G242 (= G263), E243 (= E264), M264 (≠ Q289), D266 (= D291), H293 (= H321), F294 (≠ G322), A295 (≠ G323), E313 (≠ S341)
- binding calcium ion: A232 (= A253), F235 (≠ Y256)
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
28% identity, 98% coverage: 4:385/390 of query aligns to 7:366/373 of 3cb3A
- active site: K24 (≠ Y21), S57 (≠ N53), T143 (≠ A151), K171 (= K181), K173 (= K183), D202 (= D212), N204 (= N214), E228 (= E238), G253 (= G263), E254 (= E264), M275 (≠ Q289), D277 (= D291), H304 (= H321), F305 (≠ G322), A306 (≠ G323), E324 (≠ S341)
- binding l-glucaric acid: K171 (= K181), K173 (= K183), D202 (= D212), E254 (= E264), H304 (= H321)
- binding magnesium ion: D202 (= D212), E228 (= E238), A243 (= A253), F246 (≠ Y256), E254 (= E264)
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
28% identity, 69% coverage: 105:374/390 of query aligns to 99:351/367 of 5xd8B
- active site: G140 (≠ A152), K167 (= K181), K169 (= K183), D198 (= D212), N200 (= N214), E224 (= E238), G249 (= G263), E250 (= E264), Q271 (≠ R282), D273 (= D284), H300 (= H321), G301 (= G322), M302 (≠ G323), W317 (≠ G338), E319 (= E340), P324 (≠ V345)
- binding magnesium ion: D198 (= D212), E224 (= E238), E250 (= E264)
Sites not aligning to the query:
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
27% identity, 88% coverage: 47:388/390 of query aligns to 45:372/372 of 4h19A
- active site: T51 (≠ N53), T143 (≠ A152), K172 (= K181), K174 (= K183), D203 (= D212), N205 (= N214), E229 (= E238), G254 (= G263), E255 (= E264), Q276 (= Q289), D278 (= D291), H305 (= H321), A306 (≠ G322), G307 (= G323), E327 (≠ K347)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: H52 (≠ G54), K172 (= K181), K174 (= K183), D203 (= D212), N205 (= N214), E229 (= E238), E255 (= E264), H305 (= H321), E327 (≠ K347)
- binding calcium ion: D268 (≠ R277), H298 (≠ N311)
- binding magnesium ion: D203 (= D212), E229 (= E238), E255 (= E264)
Sites not aligning to the query:
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
31% identity, 73% coverage: 90:372/390 of query aligns to 84:347/361 of Q9RKF7
- D195 (= D212) binding
- E221 (= E238) binding
- E247 (= E264) binding
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
30% identity, 73% coverage: 90:372/390 of query aligns to 84:344/357 of 3ck5A
- active site: G137 (≠ A152), K164 (= K181), K166 (= K183), D195 (= D212), N197 (= N214), I220 (≠ Y237), E221 (= E238), I243 (≠ M260), G246 (= G263), E247 (= E264), E268 (≠ D284), D270 (= D286), H297 (= H321), G298 (= G322), V299 (≠ G323), Y315 (≠ G338), E317 (= E340)
- binding magnesium ion: D195 (= D212), E221 (= E238), E247 (= E264)
Sites not aligning to the query:
2qq6B Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from rubrobacter xylanophilus dsm 9941
26% identity, 70% coverage: 102:374/390 of query aligns to 79:377/396 of 2qq6B
- active site: G79 (= G102), D124 (= D144), K166 (= K181), D168 (≠ K183), D213 (= D212), H215 (≠ N214), E239 (= E238), G264 (= G263), E265 (= E264), M286 (≠ Q289), D288 (= D291), H315 (= H324), N316 (≠ Q325), E340 (vs. gap), D345 (vs. gap)
- binding magnesium ion: D213 (= D212), E239 (= E238), E265 (= E264), H315 (= H324)
Sites not aligning to the query:
3no1A Crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium
30% identity, 50% coverage: 109:304/390 of query aligns to 90:274/355 of 3no1A
- active site: I127 (≠ A152), K154 (= K181), K156 (= K183), I184 (≠ V211), D185 (= D212), A186 (= A213), N187 (= N214), E211 (= E238), G237 (= G263), Q238 (≠ E264), N259 (≠ Q289), D261 (= D291)
- binding magnesium ion: D185 (= D212), E211 (= E238), Q238 (≠ E264)
Sites not aligning to the query:
4h83F Crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127)
30% identity, 50% coverage: 109:304/390 of query aligns to 102:286/368 of 4h83F
- active site: I139 (≠ A152), K166 (= K181), K168 (= K183), I196 (≠ V211), D197 (= D212), A198 (= A213), N199 (= N214), E223 (= E238), G249 (= G263), Q250 (≠ E264), N271 (≠ Q289), D273 (= D291)
- binding bicarbonate ion: R220 (≠ F235)
Sites not aligning to the query:
2ox4C Crystal structure of putative dehydratase from zymomonas mobilis zm4
25% identity, 76% coverage: 87:381/390 of query aligns to 65:384/397 of 2ox4C
- active site: K165 (= K181), D167 (≠ K183), E214 (≠ D212), H216 (≠ N214), E240 (= E238), G265 (= G263), E266 (= E264), Q287 (= Q289), D289 (= D291), H316 (≠ V318), E341 (≠ P343)
- binding magnesium ion: E214 (≠ D212), E240 (= E238), E266 (= E264)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
29% identity, 70% coverage: 108:380/390 of query aligns to 98:363/376 of 3bjsB
- active site: G136 (= G153), K164 (= K181), R166 (≠ K183), D194 (= D212), N196 (= N214), E220 (= E238), G246 (= G263), E247 (= E264), N248 (= N265), Q268 (= Q289), D270 (= D291), H297 (= H324), S298 (≠ Q325), S299 (≠ M326), E322 (= E340), C324 (≠ Y342), K327 (≠ V345)
- binding magnesium ion: D194 (= D212), E220 (= E238), E247 (= E264)
Sites not aligning to the query:
3stpA Crystal structure of a putative galactonate dehydratase
29% identity, 63% coverage: 87:331/390 of query aligns to 87:328/390 of 3stpA
- active site: S151 (≠ A152), K177 (= K181), R179 (≠ K183), P189 (≠ T187), E214 (≠ D212), Y216 (≠ N214), E240 (= E238), G265 (= G263), E266 (= E264), H267 (≠ N265), Q287 (= Q289), D289 (= D291), I311 (≠ R316), H316 (= H321)
- binding magnesium ion: E214 (≠ D212), E240 (= E238), E266 (= E264)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
27% identity, 71% coverage: 105:380/390 of query aligns to 82:348/351 of 5olcC
- active site: K148 (= K181), K150 (= K183), D178 (= D212), N180 (= N214), E204 (= E238), G229 (= G263), E230 (= E264), D253 (= D291), H280 (= H321), E304 (≠ D344), E309 (≠ F349)
- binding magnesium ion: D178 (= D212), E204 (= E238), E230 (= E264)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
28% identity, 73% coverage: 90:374/390 of query aligns to 76:364/378 of 4hpnA
- active site: T134 (≠ A152), K164 (= K181), K166 (= K183), D194 (= D212), N196 (= N214), E220 (= E238), G245 (= G263), E246 (= E264), T247 (≠ N265), Q267 (= Q289), D269 (= D291), H296 (= H321), V297 (≠ G323), W298 (≠ H324), R320 (≠ K347), E329 (vs. gap), F330 (vs. gap), H334 (vs. gap)
- binding calcium ion: D194 (= D212), D209 (≠ E227), E220 (= E238), G237 (≠ H255), E246 (= E264)
Sites not aligning to the query:
Query Sequence
>AZOBR_RS17545 FitnessBrowser__azobra:AZOBR_RS17545
MRIVEIREKTVGIKSDIANAYIDFSQMTCSTVAVITDVVRDGKPVIGYGFNSNGRYGAGG
LMRERFIPRLTSAAPDSLIDEANGNLDPFKIWARLMTNEKPGGHGERSVAMGTIDMAVWD
AVAKIAGKPLYRLLADRYRGGVADESVWVYAAGGYYYPGKGVEALQNEMRSYRDRGYNVV
KMKIGATSLEDDLRRIEAVLEVVGDGRNLCVDANGRFDLKTAIAYAEALKPYNLFWYEEA
GDPLDYALQAELANHYDRPMATGENLFSHQDARNLIRHGGMRPDRDWLQFDCALSYGLVE
YMRTLDMLAENGWSSRRVVPHGGHQMSLNIAAGLHLGGNESYPDVFKPFCGFADSIAVED
GRVRLPALPGIGFEDKAELFRTMREALETA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory