SitesBLAST
Comparing AZOBR_RS19085 FitnessBrowser__azobra:AZOBR_RS19085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
47% identity, 98% coverage: 1:356/362 of query aligns to 1:363/365 of Q8Z0C8
- M82 (= M82) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (≠ Q112) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (= F205) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
Q07523 2-Hydroxyacid oxidase 2; HAOX2; (S)-2-hydroxy-acid oxidase, peroxisomal; Long chain alpha-hydroxy acid oxidase; Long-chain L-2-hydroxy acid oxidase; LCHAO; EC 1.1.3.15 from Rattus norvegicus (Rat) (see 4 papers)
39% identity, 96% coverage: 8:356/362 of query aligns to 4:348/353 of Q07523
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
41% identity, 97% coverage: 6:356/362 of query aligns to 1:348/353 of 5zbmB
- active site: Y128 (= Y133), D156 (= D161), H248 (= H256)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ I29), P76 (= P81), T77 (≠ M82), W107 (≠ Q112), Q126 (= Q131), Y128 (= Y133), T154 (= T159), K224 (= K232), H248 (= H256), G249 (= G257), R251 (= R259), D279 (= D287), G280 (= G288), R283 (= R291), G302 (= G310), R303 (≠ Q311)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
40% identity, 97% coverage: 6:356/362 of query aligns to 2:354/369 of P05414
- Y24 (= Y28) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (≠ PMA 81:83) binding
- S106 (= S110) binding
- W108 (≠ Q112) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (≠ QIY 131:133) binding
- T155 (= T159) binding
- K230 (= K232) binding
- S252 (= S254) binding
- DGGVR 285:289 (≠ DGGIR 287:291) binding
- GR 308:309 (≠ GQ 310:311) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
39% identity, 96% coverage: 8:356/362 of query aligns to 3:351/353 of 5qieA
- active site: Y129 (= Y133), D157 (= D161), H251 (= H256)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ I29), A76 (≠ P81), T77 (≠ M82), A78 (= A83), S105 (= S110), Q127 (= Q131), Y129 (= Y133), K227 (= K232), H251 (= H256), G252 (= G257), R254 (= R259), D282 (= D287), G283 (= G288), R286 (= R291), G305 (= G310), R306 (≠ Q311)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: I3 (≠ V8), D322 (≠ H327)
7r4oA Structure of human hydroxyacid oxidase 1 bound with 2-((4h-1,2,4- triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one
39% identity, 96% coverage: 8:356/362 of query aligns to 4:339/341 of 7r4oA
- binding flavin mononucleotide: Y25 (≠ I29), A77 (≠ P81), T78 (≠ M82), A79 (= A83), S106 (= S110), Q128 (= Q131), Y130 (= Y133), K215 (= K232), H239 (= H256), G240 (= G257), R242 (= R259), D270 (= D287), G271 (= G288), R274 (= R291), G293 (= G310), R294 (≠ Q311)
- binding 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one: Y132 (≠ Q135), K133 (≠ P136), D134 (≠ R137), N183 (= N186), K190 (≠ D193)
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
39% identity, 96% coverage: 8:356/362 of query aligns to 5:350/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y28), A80 (= A83), M81 (≠ F84), W109 (≠ Q112), Y131 (= Y133), R166 (= R168), M182 (≠ P184), H250 (= H256), R253 (= R259)
- binding flavin mononucleotide: Y25 (= Y28), Y26 (≠ I29), A78 (≠ P81), T79 (≠ M82), A80 (= A83), S107 (= S110), W109 (≠ Q112), Q129 (= Q131), Y131 (= Y133), T157 (= T159), K226 (= K232), H250 (= H256), G251 (= G257), R253 (= R259), D281 (= D287), G282 (= G288), R285 (= R291), G304 (= G310), R305 (≠ Q311)
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
40% identity, 97% coverage: 6:356/362 of query aligns to 2:345/350 of 1al7A
- active site: S106 (= S110), Y129 (= Y133), T155 (= T159), D157 (= D161), K221 (= K232), H245 (= H256)
- binding flavin mononucleotide: Y24 (= Y28), Y25 (≠ I29), P77 (= P81), T78 (≠ M82), A79 (= A83), S106 (= S110), Q127 (= Q131), T155 (= T159), K221 (= K232), H245 (= H256), R248 (= R259), D276 (= D287), G277 (= G288), R280 (= R291), G299 (= G310), R300 (≠ Q311)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (= Y28), W108 (≠ Q112), Y129 (= Y133), R164 (= R168), F172 (= F176), I198 (≠ L209), H245 (= H256), R248 (= R259)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
38% identity, 96% coverage: 8:356/362 of query aligns to 6:358/360 of 6gmcA
- active site: Y132 (= Y133), D160 (= D161), H258 (= H256)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y28), M82 (≠ F84), W110 (≠ Q112), Y132 (= Y133), R167 (= R168), F191 (vs. gap), L203 (≠ G201), Y206 (≠ V204), H258 (= H256), R261 (= R259)
- binding flavin mononucleotide: Y26 (= Y28), Y27 (≠ I29), A79 (≠ P81), T80 (≠ M82), A81 (= A83), S108 (= S110), Q130 (= Q131), Y132 (= Y133), T158 (= T159), K234 (= K232), H258 (= H256), G259 (= G257), R261 (= R259), D289 (= D287), G290 (= G288), R293 (= R291), G312 (= G310), R313 (≠ Q311)
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
39% identity, 96% coverage: 8:356/362 of query aligns to 3:342/344 of 5qihA
- active site: Y129 (= Y133), D157 (= D161), H242 (= H256)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ I29), A76 (≠ P81), T77 (≠ M82), A78 (= A83), S105 (= S110), Q127 (= Q131), Y129 (= Y133), K218 (= K232), H242 (= H256), G243 (= G257), R245 (= R259), D273 (= D287), G274 (= G288), R277 (= R291), G296 (= G310), R297 (≠ Q311)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y28), A78 (= A83), M79 (≠ F84), W107 (≠ Q112), Y129 (= Y133), M180 (≠ P184), L187 (= L190), H242 (= H256)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
39% identity, 96% coverage: 8:356/362 of query aligns to 3:342/344 of 5qidA
- active site: Y129 (= Y133), D157 (= D161), H242 (= H256)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ I29), A76 (≠ P81), T77 (≠ M82), A78 (= A83), S105 (= S110), Q127 (= Q131), Y129 (= Y133), K218 (= K232), H242 (= H256), G243 (= G257), R245 (= R259), D273 (= D287), G274 (= G288), R277 (= R291), G296 (= G310), R297 (≠ Q311)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ A62), E320 (≠ T334), R323 (≠ E337)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
39% identity, 96% coverage: 8:356/362 of query aligns to 3:342/344 of 5qicA
- active site: Y129 (= Y133), D157 (= D161), H242 (= H256)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ I29), A76 (≠ P81), T77 (≠ M82), A78 (= A83), S105 (= S110), Q127 (= Q131), Y129 (= Y133), K218 (= K232), H242 (= H256), G243 (= G257), R245 (= R259), D273 (= D287), G274 (= G288), R277 (= R291), G296 (= G310), R297 (≠ Q311)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (≠ Q135), K132 (≠ P136), V136 (≠ D140), M180 (≠ P184), F183 (≠ L187), Y190 (≠ D193), K193 (≠ T196), A194 (≠ P197)
5qibA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with fmopl000388a
39% identity, 96% coverage: 8:356/362 of query aligns to 3:342/344 of 5qibA
- active site: Y129 (= Y133), D157 (= D161), H242 (= H256)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: Y23 (= Y28), Y24 (≠ I29), A76 (≠ P81), T77 (≠ M82), A78 (= A83), S105 (= S110), Q127 (= Q131), Y129 (= Y133), K218 (= K232), H242 (= H256), G243 (= G257), R245 (= R259), D273 (= D287), G274 (= G288), G275 (= G289), R277 (= R291), G296 (= G310), R297 (≠ Q311)
- binding 5-(cyclohexylamino)pyrimidine-2,4(1H,3H)-dione: Y23 (= Y28), M79 (≠ F84), W107 (≠ Q112), Y129 (= Y133), R164 (= R168), M180 (≠ P184), L187 (= L190), H242 (= H256), R245 (= R259)
1al8A Three-dimensional structure of glycolate oxidase with bound active- site inhibitors (see paper)
40% identity, 97% coverage: 6:356/362 of query aligns to 2:339/344 of 1al8A
- active site: S106 (= S110), Y129 (= Y133), T155 (= T159), D157 (= D161), K215 (= K232), H239 (= H256)
- binding 3-decyl-2,5-dioxo-4-hydroxy-3-pyrroline: Y24 (= Y28), W108 (≠ Q112), Y129 (= Y133), F166 (= F176), H239 (= H256), R242 (= R259)
- binding flavin mononucleotide: Y25 (≠ I29), P77 (= P81), T78 (≠ M82), A79 (= A83), S106 (= S110), Q127 (= Q131), Y129 (= Y133), T155 (= T159), K215 (= K232), H239 (= H256), R242 (= R259), D270 (= D287), G271 (= G288), R274 (= R291), G293 (= G310), R294 (≠ Q311)
5zzqA The crystal structure of mandelate oxidase with (s)-4-hydroxymandelic acid (see paper)
43% identity, 93% coverage: 8:344/362 of query aligns to 2:338/355 of 5zzqA
- active site: Y126 (= Y133), D154 (= D161), H250 (= H256)
- binding flavin mononucleotide: P75 (= P81), V76 (≠ M82), A77 (= A83), Q124 (= Q131), Y126 (= Y133), T152 (= T159), K226 (= K232), H250 (= H256), R253 (= R259), D281 (= D287), G283 (= G289), R285 (= R291), G304 (= G310), R305 (≠ Q311)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: L106 (≠ Q112), Y126 (= Y133), M158 (≠ S165), R161 (= R168), T200 (≠ Q206), F204 (≠ H210), H250 (= H256), R253 (= R259)
6a24A The crystal structure of mandelate oxidase with 3-fluoropyruvate (see paper)
43% identity, 93% coverage: 8:344/362 of query aligns to 2:338/354 of 6a24A
- active site: Y126 (= Y133), D154 (= D161), H250 (= H256)
- binding flavin mononucleotide: P75 (= P81), V76 (≠ M82), A77 (= A83), Q124 (= Q131), Y126 (= Y133), T152 (= T159), K226 (= K232), H250 (= H256), G251 (= G257), R253 (= R259), D281 (= D287), G282 (= G288), G283 (= G289), R285 (= R291), G304 (= G310), R305 (≠ Q311)
- binding pyruvic acid: R161 (= R168), H250 (= H256), R253 (= R259)
6a08A The crystal structure of mandelate oxidase with benzoyl-formic acid (see paper)
43% identity, 93% coverage: 8:344/362 of query aligns to 3:318/335 of 6a08A
- active site: Y127 (= Y133), D155 (= D161), H230 (= H256)
- binding benzoyl-formic acid: A78 (= A83), Y127 (= Y133), V156 (≠ A162), W158 (≠ V164), M159 (≠ S165), M159 (≠ S165), F184 (= F195), H230 (= H256), R233 (= R259)
- binding flavin mononucleotide: P76 (= P81), V77 (≠ M82), A78 (= A83), Q125 (= Q131), Y127 (= Y133), T153 (= T159), K206 (= K232), H230 (= H256), G231 (= G257), R233 (= R259), D261 (= D287), G263 (= G289), R265 (= R291), G284 (= G310), R285 (≠ Q311)
- binding magnesium ion: D261 (= D287), G262 (= G288), I264 (= I290), L282 (= L308)
6a01A The crystal structure of mandelate oxidase y128f with 3,3-difluoro-2, 2-dihydroxy-3-phenylpropionic acid (see paper)
42% identity, 93% coverage: 8:344/362 of query aligns to 2:317/333 of 6a01A
- active site: F126 (≠ Y133), D154 (= D161), H229 (= H256)
- binding 3,3-difluoro-2,2-dihydroxy-3-phenylpropanoic acid: F22 (≠ Y28), F126 (≠ Y133), M158 (≠ S165), R161 (= R168), H229 (= H256), R232 (= R259)
- binding flavin mononucleotide: P75 (= P81), V76 (≠ M82), A77 (= A83), Q124 (= Q131), F126 (≠ Y133), T152 (= T159), K205 (= K232), H229 (= H256), R232 (= R259), D260 (= D287), G262 (= G289), R264 (= R291), G283 (= G310), R284 (≠ Q311)
6a1aA Mandelate oxidase mutant-y128f with 4-hydroxymandelic acid (see paper)
42% identity, 93% coverage: 8:344/362 of query aligns to 3:318/335 of 6a1aA
- active site: F127 (≠ Y133), D155 (= D161), H230 (= H256)
- binding flavin mononucleotide: P76 (= P81), V77 (≠ M82), A78 (= A83), Q125 (= Q131), F127 (≠ Y133), T153 (= T159), K206 (= K232), H230 (= H256), R233 (= R259), D261 (= D287), G263 (= G289), R265 (= R291), G284 (= G310), R285 (≠ Q311)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: A40 (= A45), R43 (= R48), L107 (≠ Q112), F127 (≠ Y133), V156 (≠ A162), M159 (≠ S165), R162 (= R168), F184 (= F195), H230 (= H256), R233 (= R259), E243 (= E269)
Sites not aligning to the query:
6a1wA Mandelate oxidase with the enoyl fmn epoxide adduct (see paper)
42% identity, 93% coverage: 8:344/362 of query aligns to 3:317/334 of 6a1wA
- active site: Y127 (= Y133), D155 (= D161), H229 (= H256)
- binding 1-[(1aR,11R)-11-acetyl-8,9-dimethyl-2,4-dioxo-3,4-dihydrobenzo[g]oxazireno[3,2-e]pteridin-11-ium-6(2H)-yl]-1-deoxy-5-O-phosphono-D-ribitol: L24 (≠ I29), A75 (= A80), P76 (= P81), V77 (≠ M82), Q125 (= Q131), Y127 (= Y133), T153 (= T159), R162 (= R168), K205 (= K232), H229 (= H256), R232 (= R259), D260 (= D287), G262 (= G289), R264 (= R291), G283 (= G310), R284 (≠ Q311)
- binding magnesium ion: D260 (= D287), G261 (= G288), I263 (= I290), L281 (= L308)
Query Sequence
>AZOBR_RS19085 FitnessBrowser__azobra:AZOBR_RS19085
MSVPADTVSLYDYERHFTARVDAATRAYIAGTGADGITRQANRDAYDRMRLMPRALRDLS
GASAATSLFGQAMPYPILIAPMAFHRLVHRDGERATAQAAGLTGTWMTVSTQSSVTLEEV
AAAAGGPLWFQIYTQPRPEDTLALVRRAEAAGYRALVLTVDAPVSGLRNIEQRAGFRLPD
GIAPVNLAGLAPDSFTPTRPGSPVFQGMLHAAASWDTVRWLCAETRLPVLLKGIMNPDDV
DLAVEAGAAGIIVSNHGGRTLDTLPAVAEVLPLVATRAAGRLPILADGGIRRGTDILKAL
ALGADAVLVGQPVLHALAVGGMAGVAHMLTILQTELEVAMALSGRARLADIDRSVIFDPP
RW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory