Comparing AZOBR_RS19240 FitnessBrowser__azobra:AZOBR_RS19240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
56% identity, 91% coverage: 28:357/364 of query aligns to 1:330/344 of 4yicA
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
55% identity, 99% coverage: 1:359/364 of query aligns to 1:359/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
55% identity, 91% coverage: 30:359/364 of query aligns to 2:331/337 of 2hzlB
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
49% identity, 88% coverage: 30:349/364 of query aligns to 3:322/330 of 7ug8B
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
39% identity, 88% coverage: 33:352/364 of query aligns to 4:324/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
37% identity, 88% coverage: 33:352/364 of query aligns to 5:325/329 of 4petA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 87% coverage: 1:315/364 of query aligns to 4:311/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
29% identity, 71% coverage: 57:315/364 of query aligns to 27:280/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
29% identity, 71% coverage: 57:315/364 of query aligns to 27:280/330 of 2zzvA
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
25% identity, 86% coverage: 30:342/364 of query aligns to 1:308/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
25% identity, 85% coverage: 32:342/364 of query aligns to 2:307/315 of 4uabA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
29% identity, 64% coverage: 34:266/364 of query aligns to 3:235/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
30% identity, 43% coverage: 54:211/364 of query aligns to 24:182/563 of 7e9yA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
22% identity, 74% coverage: 31:298/364 of query aligns to 3:267/304 of 4x8rA
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
25% identity, 73% coverage: 35:298/364 of query aligns to 4:265/306 of 4xfeA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
22% identity, 73% coverage: 34:298/364 of query aligns to 3:264/300 of 4n8yA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
23% identity, 67% coverage: 52:295/364 of query aligns to 21:262/301 of 4pdhA
Sites not aligning to the query:
4n6dA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site (see paper)
22% identity, 59% coverage: 56:270/364 of query aligns to 26:238/319 of 4n6dA
4mncA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21 (see paper)
21% identity, 70% coverage: 31:286/364 of query aligns to 2:249/305 of 4mncA
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
24% identity, 84% coverage: 37:340/364 of query aligns to 11:302/302 of 4mijA
Sites not aligning to the query:
>AZOBR_RS19240 FitnessBrowser__azobra:AZOBR_RS19240
MKRRSFLASAGVGLAASTVVAAPAIAQSQPEIKWRMASSYPKSLDTIFGGAELIARRVAA
ATDNKFQIRTFAAGEIVPALQVLDAVQNGTIECGQSAAYFYIGKDPTFCFDTAMPFGLNT
RQHISWMMHGGGLELMRELFREHNIYNIPAGNTTAQMGGWFRKEIKTVEDLSGLKMRVGG
LAGQIMGKLGLVPQQIGGGDIYPALERGTIDAAEFVGPYDDEKLGFHKVAKYYYSPGWWE
GSAQIPLMINITAWEQLPESYKTILEQACWEANTWMIAKYDAVNAAALKRLVAGGAQLRA
FPRDVMMACEKIANELYDELSAKNPRFKKVYEAWKPFRDEERLWFRVAENSFDSYVYSQS
AQRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory