Comparing AZOBR_RS20010 FitnessBrowser__azobra:AZOBR_RS20010 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
60% identity, 90% coverage: 29:355/365 of query aligns to 2:328/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
58% identity, 97% coverage: 1:355/365 of query aligns to 1:356/365 of Q3J1R2
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
53% identity, 90% coverage: 27:356/365 of query aligns to 1:330/344 of 4yicA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
51% identity, 89% coverage: 29:354/365 of query aligns to 3:328/330 of 7ug8B
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
38% identity, 88% coverage: 32:354/365 of query aligns to 5:329/329 of 4petA
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
38% identity, 88% coverage: 32:351/365 of query aligns to 4:324/331 of 5cm6A
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 74% coverage: 1:270/365 of query aligns to 4:278/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
28% identity, 72% coverage: 32:295/365 of query aligns to 4:272/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
28% identity, 72% coverage: 32:295/365 of query aligns to 4:272/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
31% identity, 59% coverage: 54:267/365 of query aligns to 23:236/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
28% identity, 49% coverage: 32:210/365 of query aligns to 4:182/563 of 7e9yA
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
24% identity, 84% coverage: 29:336/365 of query aligns to 1:303/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
24% identity, 84% coverage: 31:336/365 of query aligns to 2:302/315 of 4uabA
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
23% identity, 62% coverage: 47:271/365 of query aligns to 17:240/305 of 2cexB
Sites not aligning to the query:
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
23% identity, 62% coverage: 47:271/365 of query aligns to 17:240/304 of 2cexA
Sites not aligning to the query:
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
23% identity, 62% coverage: 47:271/365 of query aligns to 18:241/308 of 2wx9A
Sites not aligning to the query:
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
23% identity, 62% coverage: 47:271/365 of query aligns to 41:264/329 of P44542
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
23% identity, 62% coverage: 47:271/365 of query aligns to 18:241/310 of 3b50A
Sites not aligning to the query:
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
23% identity, 62% coverage: 47:271/365 of query aligns to 18:241/309 of 2v4cA
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
23% identity, 62% coverage: 47:271/365 of query aligns to 18:241/308 of 2xwoA
Sites not aligning to the query:
>AZOBR_RS20010 FitnessBrowser__azobra:AZOBR_RS20010
MKRRTFITSAGVGVAASTLAAPAIAQSNPEIKWRCASSFPKSLDTIYGGAERVAKRVAEM
TEGKFQIRTFASGEIVPGLQVLDAVKDGTVECGHTVSYYYVGKDPTFAFDAAMPFGLNAR
QQNAWMTHGGGMELMREFFKGYNIVQFAAGNTGTQMGGWFRNELKTVEDLKGLKFRIGGY
AGTILQRLGVVPQQIAGGDIYPALEKGTIDAAEWVGPYDDEKLGFNKVAKYYYYPGWWEG
GPQVSFLVSLPQWEQLPKHYQAILEAACADATADMVGKYDVVNMHALKRLVGAGTVLKPY
PRDILQACYQATFDVYEEEAAKNEKFRKVYEQWRKFRDEEYLWFRVAENTFDNFVYSAPT
PKKKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory