SitesBLAST
Comparing AZOBR_RS25735 FitnessBrowser__azobra:AZOBR_RS25735 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
43% identity, 90% coverage: 7:491/537 of query aligns to 4:498/535 of 3wy2A
- active site: D97 (= D100), R197 (= R200), D199 (= D202), E268 (= E266), H329 (= H327), D330 (= D328)
- binding beta-D-glucopyranose: D59 (= D62), Y62 (= Y65), H102 (= H105), R197 (= R200), D199 (= D202), E268 (= E266), H329 (= H327), D330 (= D328), R397 (= R390)
- binding glycerol: S101 (≠ N104), D169 (= D172), V170 (≠ L173), P175 (= P178), R178 (= R181), Q179 (≠ E182), F203 (≠ H206), Y204 (≠ L207), H206 (≠ K209), D240 (≠ T237), P244 (= P241), E280 (≠ Y277)
- binding magnesium ion: D20 (= D23), R22 (≠ N25), V26 (= V29), D28 (= D31)
3wy1A Crystal structure of alpha-glucosidase (see paper)
43% identity, 90% coverage: 7:491/537 of query aligns to 4:498/535 of 3wy1A
- active site: D97 (= D100), R197 (= R200), D199 (= D202), E268 (= E266), H329 (= H327), D330 (= D328)
- binding glycerol: S101 (≠ N104), D169 (= D172), V170 (≠ L173), F203 (≠ H206), Y204 (≠ L207), H206 (≠ K209)
- binding magnesium ion: D20 (= D23), D24 (= D27), V26 (= V29), D28 (= D31)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D62), Y62 (= Y65), H102 (= H105), F144 (= F147), F163 (≠ Y166), R197 (= R200), D199 (= D202), T200 (≠ A203), G225 (vs. gap), E268 (= E266), F294 (= F291), H329 (= H327), D330 (= D328), R397 (= R390)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
43% identity, 90% coverage: 7:491/537 of query aligns to 4:498/535 of 3wy4A
- active site: D97 (= D100), R197 (= R200), D199 (= D202), Q268 (≠ E266), H329 (= H327), D330 (= D328)
- binding alpha-D-glucopyranose: D59 (= D62), Y62 (= Y65), H102 (= H105), I143 (≠ E146), F163 (≠ Y166), D199 (= D202), T200 (≠ A203), G225 (vs. gap), Q268 (≠ E266), Q268 (≠ E266), F294 (= F291), H329 (= H327), D330 (= D328), R397 (= R390), R397 (= R390)
- binding glycerol: S101 (≠ N104), D169 (= D172), V170 (≠ L173), F203 (≠ H206), Y204 (≠ L207), H206 (≠ K209), L224 (vs. gap), G225 (vs. gap), A226 (vs. gap), P227 (vs. gap), F294 (= F291), D330 (= D328), E374 (≠ D367), K395 (≠ L388), G396 (= G389), G399 (≠ P392)
- binding magnesium ion: D20 (= D23), D24 (= D27), V26 (= V29), D28 (= D31)
2ze0A Alpha-glucosidase gsj (see paper)
42% identity, 89% coverage: 6:485/537 of query aligns to 3:483/531 of 2ze0A
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
39% identity, 93% coverage: 4:500/537 of query aligns to 3:524/557 of 4h8vA
- active site: D99 (= D100), R198 (= R200), D200 (= D202), E254 (= E266), H326 (= H327), D327 (= D328)
- binding calcium ion: D22 (= D23), N24 (= N25), D26 (= D27), I28 (≠ V29), D30 (= D31)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (≠ Y166), D200 (= D202), E254 (= E266), F256 (≠ Y268), R284 (vs. gap), R291 (vs. gap), H326 (= H327), D327 (= D328), E386 (≠ N382), R414 (= R390)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
39% identity, 93% coverage: 4:500/537 of query aligns to 3:524/557 of 2pwdA
- active site: D99 (= D100), R198 (= R200), D200 (= D202), E254 (= E266), H326 (= H327), D327 (= D328)
- binding calcium ion: D22 (= D23), N24 (= N25), D26 (= D27), I28 (≠ V29), D30 (= D31)
- binding 1-deoxynojirimycin: D61 (= D62), Y64 (= Y65), H104 (= H105), F164 (≠ Y166), D200 (= D202), E254 (= E266), H326 (= H327), D327 (= D328), R414 (= R390)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
39% identity, 93% coverage: 4:500/537 of query aligns to 2:523/556 of 2pwgA
- active site: D98 (= D100), R197 (= R200), D199 (= D202), E253 (= E266), H325 (= H327), D326 (= D328)
- binding calcium ion: D21 (= D23), N23 (= N25), D25 (= D27), I27 (≠ V29), D29 (= D31)
- binding castanospermine: D60 (= D62), Y63 (= Y65), H103 (= H105), F163 (≠ Y166), D199 (= D202), E253 (= E266), D326 (= D328), R413 (= R390)
6k5pC Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
40% identity, 97% coverage: 7:527/537 of query aligns to 4:527/531 of 6k5pC
- active site: D97 (= D100), R196 (= R200), D198 (= D202), E264 (= E266), H331 (= H327), D332 (= D328)
- binding calcium ion: N101 (= N104), D168 (= D172), H202 (= H206), M203 (≠ L207), E205 (≠ K209)
- binding cobalt (ii) ion: H429 (≠ A437), H433 (≠ A441)
6k5pB Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
40% identity, 97% coverage: 7:527/537 of query aligns to 4:527/531 of 6k5pB
- active site: D97 (= D100), R196 (= R200), D198 (= D202), E264 (= E266), H331 (= H327), D332 (= D328)
- binding calcium ion: N101 (= N104), D168 (= D172), H202 (= H206), M203 (≠ L207), E205 (≠ K209)
- binding magnesium ion: H7 (≠ S10), A8 (≠ G11)
6k5pA Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
40% identity, 97% coverage: 7:527/537 of query aligns to 4:527/531 of 6k5pA
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
39% identity, 93% coverage: 4:500/537 of query aligns to 2:523/556 of 2pweA
- active site: D98 (= D100), R197 (= R200), D199 (= D202), Q253 (≠ E266), H325 (= H327), D326 (= D328)
- binding calcium ion: D21 (= D23), N23 (= N25), D25 (= D27), I27 (≠ V29), D29 (= D31)
- binding beta-D-fructofuranose: F163 (≠ Y166), Q253 (≠ E266), F255 (≠ Y268), D326 (= D328), R413 (= R390)
- binding alpha-D-glucopyranose: D60 (= D62), Y63 (= Y65), H103 (= H105), F163 (≠ Y166), D199 (= D202), Q253 (≠ E266), H325 (= H327), D326 (= D328), R413 (= R390)
2pwfA Crystal structure of the mutb d200a mutant in complex with glucose (see paper)
39% identity, 93% coverage: 4:500/537 of query aligns to 1:522/555 of 2pwfA
- active site: D97 (= D100), R196 (= R200), A198 (≠ D202), E252 (= E266), H324 (= H327), D325 (= D328)
- binding beta-D-glucopyranose: D59 (= D62), Y62 (= Y65), H102 (= H105), F162 (≠ Y166), R196 (= R200), A198 (≠ D202), E252 (= E266), H324 (= H327), D325 (= D328), R412 (= R390)
- binding calcium ion: D20 (= D23), N22 (= N25), D24 (= D27), I26 (≠ V29), D28 (= D31)
4ha1A Mutb inactive double mutant d200a-d415n in complex with isomaltulose
39% identity, 93% coverage: 4:500/537 of query aligns to 2:523/556 of 4ha1A
- active site: D98 (= D100), R197 (= R200), A199 (≠ D202), E253 (= E266), H325 (= H327), D326 (= D328)
- binding calcium ion: D21 (= D23), N23 (= N25), D25 (= D27), I27 (≠ V29), D29 (= D31)
- binding 6-O-alpha-D-glucopyranosyl-D-fructose: D60 (= D62), Y63 (= Y65), H103 (= H105), F163 (≠ Y166), E253 (= E266), R283 (vs. gap), H325 (= H327), D326 (= D328), E385 (≠ N382), R413 (= R390)
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
36% identity, 97% coverage: 7:526/537 of query aligns to 2:555/559 of 4mazA
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
36% identity, 97% coverage: 7:526/537 of query aligns to 4:557/561 of O06994
- D20 (= D23) binding
- N22 (= N25) binding
- D24 (= D27) binding
- F26 (≠ V29) binding
- D28 (= D31) binding
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
36% identity, 97% coverage: 7:526/537 of query aligns to 2:555/559 of 7lv6B
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
36% identity, 97% coverage: 7:526/537 of query aligns to 2:552/556 of 5wczA
- active site: D95 (= D100), R195 (= R200), D197 (= D202), E250 (= E266), H326 (= H327), D327 (= D328)
- binding 1-deoxynojirimycin: D57 (= D62), Y60 (= Y65), H100 (= H105), F161 (≠ Y166), D197 (= D202), V198 (≠ A203), E250 (= E266), H326 (= H327), D327 (= D328), R413 (= R390)
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
36% identity, 97% coverage: 7:526/537 of query aligns to 2:551/555 of 4m56A
- active site: D95 (= D100), R195 (= R200), D197 (= D202), E250 (= E266), H326 (= H327), D327 (= D328)
- binding D-glucose: D57 (= D62), Y60 (= Y65), H100 (= H105), F142 (= F147), D197 (= D202), E250 (= E266), D327 (= D328), R413 (= R390)
Q07837 Amino acid transporter heavy chain SLC3A1; D2h; Neutral and basic amino acid transport protein; NBAT; Solute carrier family 3 member 1; b(0,+)-type amino acid transporter-related heavy chain; rBAT from Homo sapiens (Human) (see 16 papers)
37% identity, 98% coverage: 7:533/537 of query aligns to 117:654/685 of Q07837
- V183 (= V73) to A: in CSNU; uncertain significance; impairs protein stability and dimer formation; dbSNP:rs1233216697
- N214 (= N104) binding
- T216 (≠ S106) to M: in CSNU; impairs protein stability and dimer formation; dbSNP:rs369641941
- C242 (≠ A133) modified: Disulfide link with 273
- E268 (≠ A156) to K: in CSNU; reduction in amino acid transport activity; dbSNP:rs757239030
- C273 (≠ Y161) modified: Disulfide link with 242
- D284 (= D172) binding
- F318 (≠ H206) binding
- L319 (= L207) binding
- E321 (≠ K209) binding
- T341 (≠ S227) to A: in CSNU; reduction in amino acid transport activity; dbSNP:rs200287661
- L346 (= L232) to P: in CSNU; uncertain significance
- I445 (≠ L324) to T: in CSNU; uncertain significance; dbSNP:rs187962930
- M467 (= M346) to T: in CSNU; impairs protein stability and dimer formation; loss of 80% of amino acid transport activity; dbSNP:rs121912691
- C571 (≠ E458) modified: Disulfide link with 666
- M618 (≠ A498) to I: in dbSNP:rs698761
Sites not aligning to the query:
- 114 modified: Interchain (with C-144 in SLC7A5)
- 666 modified: Disulfide link with 571
- 673 modified: Disulfide link with 685; C → R: in CSNU; uncertain significance; dbSNP:rs756823144
- 685 modified: Disulfide link with 673
6li9A Heteromeric amino acid transporter b0,+at-rbat complex bound with arginine (see paper)
37% identity, 98% coverage: 7:533/537 of query aligns to 55:592/623 of 6li9A
Query Sequence
>AZOBR_RS25735 FitnessBrowser__azobra:AZOBR_RS25735
MADGFAWWQSGVIYQVYPRSFQDSNGDGVGDLPGILARLDHLQTLGVDALWVSPIYPSPM
ADFGYDVSDYTGVHPLFGTMEDFERLLAELHRRGMKLILDFVPNHSSDRHPWFQASRSSR
DDPKRDWYIWRDAAPDGGPPNNWLSEFGGGAWEWDAATGQYYYHAYLKEQPDLNWRNPAL
REAMLDALRVWLDRGVDGFRVDAIHHLIKDAQFRDNPPNPGWREGMSPVRRLIRLHTVDQ
PEVHDAIAAMRRVADGYGPDRLLIGEAYLPIDQLMAYYGADLTGFQLPFNFHLLSTPWEA
KALAALIRTYEAALPPGGWPNWVLGNHDRSRVASRLGRGQARVAAMLLLTLRGTPTLYQG
DEIGMTDVAIPPDRVQDPWEKNIPGLGLGRDPVRTPIPWDGGPRGGFTTGEPWLPLGPDH
ERVNVAAQAADPSSMLALHRALLSLRRAEPALSVGRYEPVSAENDVLVYERRHGRDRFRV
LLNLSAAERTVDAVPDAAHIRLSTHLDRGGEPVSGALRLRPDEGVVIGFDDKGKGGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory