Comparing AZOBR_RS27935 FitnessBrowser__azobra:AZOBR_RS27935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
31% identity, 75% coverage: 69:306/317 of query aligns to 38:272/274 of 2ioyA
Sites not aligning to the query:
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
32% identity, 78% coverage: 60:307/317 of query aligns to 29:276/301 of 2x7xA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
25% identity, 92% coverage: 20:312/317 of query aligns to 1:284/284 of 7e7mC
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 63% coverage: 62:262/317 of query aligns to 63:264/349 of A0QYB3
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
31% identity, 63% coverage: 62:262/317 of query aligns to 30:231/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
31% identity, 63% coverage: 62:262/317 of query aligns to 30:231/315 of 4rs3A
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
27% identity, 80% coverage: 52:305/317 of query aligns to 23:271/271 of 1dbpA
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
25% identity, 90% coverage: 27:310/317 of query aligns to 1:286/292 of 2fn8A
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
28% identity, 66% coverage: 65:274/317 of query aligns to 36:240/270 of 4zjpA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 77% coverage: 62:306/317 of query aligns to 63:306/349 of A0QYB5
Sites not aligning to the query:
2rjoA Crystal structure of twin-arginine translocation pathway signal protein from burkholderia phytofirmans
30% identity, 68% coverage: 92:306/317 of query aligns to 65:293/322 of 2rjoA
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
29% identity, 77% coverage: 62:306/317 of query aligns to 31:274/315 of 4rsmA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
26% identity, 74% coverage: 50:285/317 of query aligns to 22:263/287 of 5dteB
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
24% identity, 77% coverage: 75:317/317 of query aligns to 46:297/297 of 4ry9B
Sites not aligning to the query:
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
24% identity, 77% coverage: 75:317/317 of query aligns to 46:297/297 of 4ry9A
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
24% identity, 91% coverage: 21:310/317 of query aligns to 1:283/287 of 4yo7A
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
26% identity, 88% coverage: 28:307/317 of query aligns to 24:306/318 of P39325
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
26% identity, 88% coverage: 28:307/317 of query aligns to 2:284/296 of 2vk2A
3ma0A Closed liganded crystal structure of xylose binding protein from escherichia coli (see paper)
26% identity, 64% coverage: 55:256/317 of query aligns to 13:231/313 of 3ma0A
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
25% identity, 58% coverage: 72:256/317 of query aligns to 44:236/288 of 1rpjA
Sites not aligning to the query:
>AZOBR_RS27935 FitnessBrowser__azobra:AZOBR_RS27935
MTFRFGLAAALAAGLMVAPVTGWAQQKIKMGVSIPAATHGWAGGLNWHAQQAEKRLEKQY
PNLDVVIVTARDVGRQANDLEDLVSVQRIDALVILPFESAPMTDPVRAVKQAGKFVTVVD
RGLTDPSIQDLYVAGNNPQMGEVSARFMKEKMGGKGDIVVLRGIPTVIDNQRVDAFMKEI
EGTQIKVLGMQYANWNRDDGFKVMQDFLSRFPKIDAVWAQDDDIALGVIEAVKQAGREKE
MFILGGAGMKDMIKRVMDKDVLVPADVLYPPAMIAEAMEITAKHLVEKAPIQKEYIIEAT
LVTPENAAKYYYPDSPF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory