Comparing AZOBR_RS30430 FitnessBrowser__azobra:AZOBR_RS30430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
31% identity, 79% coverage: 61:311/319 of query aligns to 47:299/303 of 1wogA
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
31% identity, 92% coverage: 13:307/319 of query aligns to 17:304/315 of 3niqA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
31% identity, 92% coverage: 13:307/319 of query aligns to 18:305/316 of 3nipB
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 92% coverage: 13:307/319 of query aligns to 20:307/318 of Q9I6K2
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 70% coverage: 86:307/319 of query aligns to 85:310/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
32% identity, 70% coverage: 86:307/319 of query aligns to 82:307/316 of 3nioA
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
29% identity, 93% coverage: 12:308/319 of query aligns to 3:283/293 of 3pzlB
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
30% identity, 71% coverage: 87:313/319 of query aligns to 78:308/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
30% identity, 71% coverage: 87:313/319 of query aligns to 70:300/301 of 1gq6B
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
27% identity, 79% coverage: 61:312/319 of query aligns to 25:276/276 of 3lhlA
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
30% identity, 63% coverage: 109:309/319 of query aligns to 116:315/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 63% coverage: 109:309/319 of query aligns to 140:339/342 of P46637
Sites not aligning to the query:
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
30% identity, 84% coverage: 36:302/319 of query aligns to 23:275/284 of Q57757
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
31% identity, 63% coverage: 109:309/319 of query aligns to 136:335/338 of G7JFU5
Sites not aligning to the query:
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
31% identity, 63% coverage: 109:309/319 of query aligns to 118:317/320 of 6vstD
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
31% identity, 63% coverage: 109:309/319 of query aligns to 115:314/317 of 6vstA
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
28% identity, 87% coverage: 16:294/319 of query aligns to 19:284/306 of P60651
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
28% identity, 87% coverage: 16:294/319 of query aligns to 9:274/294 of 7lolA
7lbaB E. Coli agmatinase (see paper)
28% identity, 87% coverage: 16:294/319 of query aligns to 26:291/310 of 7lbaB
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
29% identity, 76% coverage: 54:294/319 of query aligns to 34:264/284 of 7loxA
>AZOBR_RS30430 FitnessBrowser__azobra:AZOBR_RS30430
MSSTLTNPPRRELQSFLDFPICTDLDQLDGHIGILGIPYGDPYSIDEVTNDQTNAPTWVR
RYTERALRQLERWDFDIGGPLLGGKDIKVVDCGDVKANPRDLDLHYRNAEAVVRAMLAKG
MLPIIIGGDHGIPIPVLRAYDDQGPITLVHIDAHLDWRDHVNGARGGYSSPIRRAAEMDH
VGQIFQIGLRSAGSARPEEVEAAQAYGAVLIPDVELQDVGMKAVLDRIPDGGRYYLTIDA
DGMDPTIMPAVNGPAPGGVTYPQIRTLIHGLVKKGRVVGMDIVEITPKKDVNGITAITAG
RIICNLIGKTIQAGYFDAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory