SitesBLAST
Comparing Ac3H11_1189 FitnessBrowser__acidovorax_3H11:Ac3H11_1189 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
25% identity, 72% coverage: 3:230/317 of query aligns to 12:242/345 of 3q2iA
- active site: K104 (≠ I95), H192 (= H179)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (≠ I95), N133 (≠ T123), T164 (≠ F154), R165 (= R155), Y169 (≠ N158), N188 (≠ H175), Q189 (≠ H176), H192 (= H179)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C19 (≠ A10), G20 (= G11), R21 (≠ A12), I22 (≠ F13), D44 (≠ S34), I45 (≠ R35), T81 (= T72), P82 (= P73), S83 (≠ T74), H86 (= H77), E103 (= E94), K104 (≠ I95), Q132 (≠ H122), W175 (≠ Q164), R176 (≠ A165), H192 (= H179)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 247, 248
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
24% identity, 72% coverage: 3:230/317 of query aligns to 8:238/347 of 3q2kC
- active site: K100 (≠ I95), H188 (= H179)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ A12), K100 (≠ I95), W159 (≠ F153), T160 (≠ F154), R161 (= R155), Y165 (≠ M159), N184 (≠ H175), Q185 (≠ H176), H188 (= H179)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G11), R17 (≠ A12), I18 (≠ F13), D40 (≠ S34), T41 (≠ R35), A76 (≠ C71), T77 (= T72), S79 (≠ T74), H82 (= H77), Q85 (= Q80), E99 (= E94), K100 (≠ I95), Q128 (≠ T123), W171 (≠ A165), R172 (= R166)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
26% identity, 59% coverage: 3:189/317 of query aligns to 3:193/322 of 3q2kK
- active site: K95 (≠ I95), H183 (= H179)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ A12), K95 (≠ I95), T155 (≠ F154), R156 (= R155), Y160 (≠ M159), N179 (≠ H175), Q180 (≠ H176), H183 (= H179)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G11 (= G11), R12 (≠ A12), I13 (≠ F13), D35 (≠ S34), T36 (≠ R35), T72 (= T72), P73 (= P73), S74 (≠ T74), L76 (≠ M76), H77 (= H77), E94 (= E94), K95 (≠ I95), Q123 (≠ T123), W166 (≠ A165), R167 (= R166), H183 (= H179)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
29% identity, 44% coverage: 4:143/317 of query aligns to 3:142/333 of Q2I8V6
- ASTI 9:12 (≠ AGAF 10:13) binding
- S10 (≠ G11) mutation to G: Almost no effect.
- A13 (≠ G14) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S34) mutation to D: No activity.
- ST 33:34 (≠ SR 34:35) binding
- R38 (≠ K39) binding
- TTNELH 71:76 (≠ TPTQMH 72:77) binding
- EK 93:94 (≠ EI 94:95) binding
- K94 (≠ I95) mutation to G: Less than 1% remaining activity.
- N120 (≠ G121) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
29% identity, 44% coverage: 4:143/317 of query aligns to 2:141/332 of 2glxA
- active site: K93 (≠ I95)
- binding acetate ion: K93 (≠ I95)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G9), A8 (= A10), S9 (≠ G11), T10 (≠ A12), I11 (≠ F13), S32 (= S34), T33 (≠ R35), R37 (≠ K39), S69 (≠ C71), T70 (= T72), N72 (≠ T74), H75 (= H77), E92 (= E94), K93 (≠ I95), H121 (≠ T123)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
31% identity, 44% coverage: 3:143/317 of query aligns to 2:142/333 of 4koaA
- active site: K94 (≠ I95)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), A9 (= A10), S10 (≠ G11), T11 (≠ A12), I12 (≠ F13), S33 (= S34), S34 (≠ R35), R38 (≠ K39), T71 (= T72), N73 (≠ T74), H76 (= H77), K94 (≠ I95)
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
32% identity, 45% coverage: 1:142/317 of query aligns to 1:145/336 of 3ec7A
- active site: K97 (≠ I95)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), M12 (≠ A12), I13 (≠ F13), D35 (≠ S34), I36 (≠ R35), R40 (≠ K39), T73 (≠ C71), A74 (≠ T72), S75 (≠ P73), N76 (≠ T74), H79 (= H77), E96 (= E94), K97 (≠ I95), M126 (≠ T123)
Sites not aligning to the query:
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
22% identity, 71% coverage: 3:226/317 of query aligns to 5:236/342 of 3ceaA
- active site: K98 (≠ I95), H185 (= H179)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), G13 (= G11), R14 (≠ A12), L15 (≠ F13), L38 (≠ R35), Q42 (≠ K39), V74 (≠ C71), A75 (≠ T72), P76 (= P73), T77 (= T74), F79 (≠ M76), H80 (= H77), M83 (≠ Q80), E97 (= E94), K98 (≠ I95), M127 (≠ T123), F169 (≠ H171), H185 (= H179)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
31% identity, 40% coverage: 16:142/317 of query aligns to 19:148/363 of 7xreC
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
34% identity, 29% coverage: 51:142/317 of query aligns to 47:138/344 of 7xr9A
Sites not aligning to the query:
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
23% identity, 97% coverage: 3:310/317 of query aligns to 4:324/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), G12 (= G11), A13 (= A12), Q14 (≠ F13), D36 (≠ S34), S37 (≠ R35), R41 (≠ K39), A73 (≠ C71), G74 (≠ T72), L78 (≠ M76), E96 (= E94), K97 (≠ I95), N125 (≠ T123), Y290 (≠ I276)
5b3uB Crystal structure of biliverdin reductase in complex with NADP+ from synechocystis sp. Pcc 6803 (see paper)
27% identity, 43% coverage: 3:137/317 of query aligns to 4:137/317 of 5b3uB
- active site: E94 (= E94), Y95 (≠ I95), E121 (≠ G121), E124 (≠ R124)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T11 (≠ A10), G12 (= G11), Y13 (≠ A12), A14 (≠ F13), N36 (≠ R35), S37 (≠ D36), N40 (≠ K39), A71 (≠ C71), T72 (= T72), I73 (≠ P73), N74 (≠ T74), H77 (= H77), E94 (= E94), Y95 (≠ I95), E121 (≠ G121)
Sites not aligning to the query:
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
28% identity, 44% coverage: 2:141/317 of query aligns to 2:143/340 of 4n54A
- active site: K96 (≠ I95)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ A12), K96 (≠ I95)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ A8), G9 (= G9), L10 (≠ A10), G11 (= G11), R12 (≠ A12), L13 (≠ F13), S35 (= S34), V36 (≠ R35), E40 (≠ K39), S73 (≠ T72), P74 (= P73), F77 (≠ M76), H78 (= H77), E95 (= E94), K96 (≠ I95), M125 (≠ T123)
Sites not aligning to the query:
- active site: 183
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: 156, 179, 180, 183, 238, 244
- binding 1,4-dihydronicotinamide adenine dinucleotide: 167, 284
5b3vA Crystal structure of biliverdin reductase in complex with biliverdin and NADP+ from synechocystis sp. Pcc 6803 (see paper)
27% identity, 43% coverage: 3:137/317 of query aligns to 3:136/317 of 5b3vA
- active site: E93 (= E94), Y94 (≠ I95), E120 (≠ G121), E123 (≠ R124)
- binding biliverdine ix alpha: Y12 (≠ A12), Y94 (≠ I95), I122 (≠ T123)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T10 (≠ A10), G11 (= G11), Y12 (≠ A12), A13 (≠ F13), N35 (≠ R35), N39 (≠ K39), A70 (≠ C71), T71 (= T72), I72 (≠ P73), N73 (≠ T74), H76 (= H77), E93 (= E94), Y94 (≠ I95), E120 (≠ G121)
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
24% identity, 58% coverage: 52:234/317 of query aligns to 52:229/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (= H122), Q173 (≠ H176), H176 (= H179)
- binding nicotinamide-adenine-dinucleotide: A71 (≠ C71), S72 (≠ T72), P73 (= P73), F76 (≠ M76), Q80 (= Q80), E94 (= E94), K95 (≠ I95), P96 (= P96), R161 (≠ T157), P163 (≠ M159), E164 (≠ N160)
Sites not aligning to the query:
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
32% identity, 30% coverage: 3:97/317 of query aligns to 2:96/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (≠ A12), M12 (≠ F13), D33 (≠ S34), L34 (≠ R35), T70 (≠ C71), T71 (= T72), P72 (= P73), N73 (≠ T74), L75 (≠ M76), H76 (= H77), Q79 (= Q80), E93 (= E94), K94 (≠ I95)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
32% identity, 30% coverage: 3:97/317 of query aligns to 2:96/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ A12)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G11), F11 (≠ A12), M12 (≠ F13), D33 (≠ S34), L34 (≠ R35), T70 (≠ C71), T71 (= T72), P72 (= P73), N73 (≠ T74), L75 (≠ M76), H76 (= H77), Q79 (= Q80), E93 (= E94), K94 (≠ I95)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 152, 154, 175, 176, 179, 236, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 122, 161, 179, 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
32% identity, 30% coverage: 3:97/317 of query aligns to 2:96/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ A12)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G9), G10 (= G11), F11 (≠ A12), M12 (≠ F13), D33 (≠ S34), L34 (≠ R35), T70 (≠ C71), T71 (= T72), P72 (= P73), N73 (≠ T74), L75 (≠ M76), H76 (= H77), Q79 (= Q80), E93 (= E94), K94 (≠ I95)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 154, 175, 179, 236, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 122, 161, 290
6z3cAAA Gfo/Idh/MocA family oxidoreductase (see paper)
25% identity, 44% coverage: 2:140/317 of query aligns to 11:146/379 of 6z3cAAA
- binding nicotinamide-adenine-dinucleotide: G20 (= G11), Y21 (≠ A12), F22 (= F13), L42 (≠ I33), D43 (≠ S34), P44 (≠ R35), A77 (≠ C71), T78 (= T72), P79 (= P73), N80 (≠ T74), H83 (= H77), E100 (= E94), K101 (≠ I95), V129 (≠ T123)
Sites not aligning to the query:
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
30% identity, 38% coverage: 16:136/317 of query aligns to 16:133/306 of 7cgqA
- binding alpha-L-arabinopyranose: K88 (≠ I95), H116 (= H122)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S34 (= S34), R35 (= R35), H36 (≠ D36), C64 (= C71), A65 (≠ T72), P66 (= P73), V69 (≠ M76), E87 (= E94), K88 (≠ I95), H116 (= H122)
Sites not aligning to the query:
Query Sequence
>Ac3H11_1189 FitnessBrowser__acidovorax_3H11:Ac3H11_1189
MTIKVALAGAGAFGIKHLDGIQNIDGVEVVSLISRDLAKTLEVADKYGIKHVTTDLADSL
AIKEVDAVILCTPTQMHASQTLACLEAGKHVQVEIPLCDVLADGEKVIALQKQTGLVAMC
GHTRRFNPSHQYVHQKITAGEFNIQQMDVQTYFFRRTNMNALGQARSWTDHLLWHHAAHT
VDLFAYQAGSPIVKANAIQGPIHKDLGIAMDMSIQLQAANGAICTLSLSFNNDGPLGTFF
RYIGDSATYIARYDDLFNGKEEKIDVSKVDVSMNGIELQDREFFAAIKEGREPNASVAQV
LPCYQVLHNLELQLNAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory