Comparing Ac3H11_13 FitnessBrowser__acidovorax_3H11:Ac3H11_13 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 89% coverage: 31:261/261 of query aligns to 3:229/229 of 5t0wA
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
28% identity, 79% coverage: 30:236/261 of query aligns to 3:211/237 of 5kkwA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
25% identity, 85% coverage: 40:260/261 of query aligns to 6:226/234 of 3k4uE
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
25% identity, 85% coverage: 40:260/261 of query aligns to 6:223/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
25% identity, 85% coverage: 40:260/261 of query aligns to 6:225/226 of 4zv1A
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
29% identity, 83% coverage: 42:258/261 of query aligns to 15:233/240 of 4h5fA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
25% identity, 90% coverage: 25:260/261 of query aligns to 1:233/240 of 2ylnA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
30% identity, 68% coverage: 31:207/261 of query aligns to 7:183/251 of 1xt8B
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
28% identity, 58% coverage: 61:212/261 of query aligns to 35:184/237 of 4i62A
Sites not aligning to the query:
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
25% identity, 87% coverage: 34:260/261 of query aligns to 7:231/247 of 2yjpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
24% identity, 85% coverage: 39:261/261 of query aligns to 2:223/224 of 4ymxA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
22% identity, 88% coverage: 31:260/261 of query aligns to 3:227/229 of 6svfA
3i6vA Crystal structure of a periplasmic his/glu/gln/arg/opine family- binding protein from silicibacter pomeroyi in complex with lysine
25% identity, 56% coverage: 40:186/261 of query aligns to 2:147/218 of 3i6vA
8gtuA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with clidinium (see paper)
24% identity, 85% coverage: 40:260/261 of query aligns to 5:223/236 of 8gtuA
8gu1A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with pimozide (see paper)
24% identity, 85% coverage: 40:260/261 of query aligns to 3:221/234 of 8gu1A
6aalA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with arginine (see paper)
24% identity, 85% coverage: 40:260/261 of query aligns to 3:221/234 of 6aalA
6a80A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with cystine (see paper)
24% identity, 85% coverage: 40:260/261 of query aligns to 3:221/234 of 6a80A
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
24% identity, 85% coverage: 38:260/261 of query aligns to 3:221/226 of 8eyzA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
22% identity, 85% coverage: 38:260/261 of query aligns to 1:220/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
22% identity, 85% coverage: 38:260/261 of query aligns to 5:224/235 of 2pvuA
>Ac3H11_13 FitnessBrowser__acidovorax_3H11:Ac3H11_13
MIPKKTLAVAAAVLVAALSLFSQAAQAGPRLDKIMEAKVIRVGTPGDYRPFAIKTDAGYS
GHDIDVIETMAKELGVKIEYVQTSWPNLVKDLQGDKFDVAVGGITRNVNRMRIFDMLPGY
APFGKVALVRAADKAKYTSVDAMNQPTVRVIKNPGGTNETYVLANLKAAQVSTHDKNAEN
PALIADGKGDVMITETYEALHYAKADPRLHAAFVDAPLTPKNYLGFMLPTDDADYVRVMG
FVWGLVDSRGTIKQAADKWLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory