SitesBLAST
Comparing Ac3H11_1539 UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
43% identity, 58% coverage: 255:603/606 of query aligns to 2:336/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G284), G34 (= G287), T35 (≠ S288), I36 (= I289), D56 (= D309), H57 (≠ V310), S82 (≠ T335), I83 (≠ V338), A104 (= A359), A105 (= A360), A106 (= A361), K108 (= K363), N123 (≠ T379), I146 (= I402), K162 (= K418), F184 (= F442), G185 (= G443), N186 (= N444), V187 (= V445), S190 (= S448), S191 (= S449)
- binding uridine-5'-diphosphate: K150 (= K406), N186 (= N444), S193 (= S451), V194 (= V452), T209 (= T467), L210 (≠ V468), T211 (= T469), I215 (= I473), R217 (= R475), E279 (= E539)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
43% identity, 58% coverage: 255:603/606 of query aligns to 2:336/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G284), G34 (= G287), T35 (≠ S288), I36 (= I289), D56 (= D309), H57 (≠ V310), S82 (≠ T335), I83 (≠ V338), A104 (= A359), A105 (= A360), A106 (= A361), K108 (= K363), N123 (≠ T379), I146 (= I402), K162 (= K418), F184 (= F442), G185 (= G443), N186 (= N444), V187 (= V445), S190 (= S448), S191 (= S449)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K363), H109 (= H364), T148 (= T404), G185 (= G443), N186 (= N444), S193 (= S451), V194 (= V452), T209 (= T467), L210 (≠ V468), T211 (= T469), I215 (= I473), R217 (= R475), R276 (= R536), E279 (= E539)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
33% identity, 48% coverage: 274:562/606 of query aligns to 2:288/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G284), T14 (≠ G286), G15 (= G287), T16 (≠ S288), I17 (= I289), S37 (≠ D309), R38 (≠ V310), S39 (= S311), D63 (≠ N337), I64 (≠ V338), V83 (≠ A359), A84 (= A360), K87 (= K363), T125 (≠ I402), S127 (≠ T404), Y137 (≠ M414), K141 (= K418), F167 (= F442), V170 (= V445), S173 (= S448), R174 (≠ S449)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K363), H88 (= H364), S127 (≠ T404), N128 (≠ D405), Y137 (≠ M414), N169 (= N444), S176 (= S451), V177 (= V452), L180 (= L455), T192 (= T467), T194 (= T469), M198 (≠ I473), R200 (= R475), L234 (≠ I510), E265 (= E539)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
36% identity, 46% coverage: 274:550/606 of query aligns to 1:269/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G284), T13 (≠ G286), G14 (= G287), S15 (= S288), F16 (≠ I289), S36 (vs. gap), R37 (vs. gap), D38 (vs. gap), K41 (≠ L318), D60 (≠ N337), V61 (= V338), A80 (= A359), A81 (= A360), A82 (= A361), K84 (= K363), T99 (= T379), L122 (≠ I402), K138 (= K418), Y164 (≠ F442)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
33% identity, 46% coverage: 275:550/606 of query aligns to 11:277/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K363), Q94 (≠ H364), N175 (= N444), S179 (= S448), R180 (≠ S449), S182 (= S451), V183 (= V452), L186 (= L455), T198 (= T467), I199 (≠ V468), T200 (= T469), M204 (≠ I473), R206 (= R475), V240 (= V511), R263 (= R536), E266 (= E539)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
33% identity, 46% coverage: 275:550/606 of query aligns to 11:277/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G284), T22 (≠ G286), G23 (= G287), S24 (= S288), F25 (≠ I289), S45 (vs. gap), R46 (vs. gap), D47 (vs. gap), K50 (≠ L318), D69 (≠ N337), V70 (= V338), A89 (= A359), A90 (= A360), A91 (= A361), K93 (= K363), L131 (≠ I402), T133 (= T404), K147 (= K418), Y173 (≠ F442)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H364), V95 (= V365), K135 (= K406), N175 (= N444), S182 (= S451), V183 (= V452), L186 (= L455), T198 (= T467), T200 (= T469), M204 (≠ I473), V240 (= V511), R263 (= R536), E266 (= E539)
Sites not aligning to the query:
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: 278, 313, 314, 315, 316, 320
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
33% identity, 46% coverage: 275:550/606 of query aligns to 3:269/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G284), T14 (≠ G286), G15 (= G287), F17 (≠ I289), S37 (vs. gap), R38 (vs. gap), D39 (vs. gap), K42 (≠ L318), D61 (≠ N337), V62 (= V338), R63 (= R339), A81 (= A359), A82 (= A360), A83 (= A361), K85 (= K363), S124 (= S403), T125 (= T404), K139 (= K418), Y165 (≠ F442), G166 (= G443)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
31% identity, 46% coverage: 273:551/606 of query aligns to 2:269/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K363), S176 (= S451), V177 (= V452), T195 (= T469), M199 (≠ I473), R201 (= R475), M235 (≠ I510), R254 (= R536), E257 (= E539)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G284), T15 (≠ G286), G16 (= G287), S17 (= S288), F18 (≠ I289), S39 (= S311), R40 (≠ E312), D41 (≠ F313), K44 (≠ Y316), D63 (≠ N337), V64 (= V338), A83 (= A359), A84 (= A360), A85 (= A361), K87 (= K363), L125 (≠ I402), S126 (= S403), Y137 (≠ M414), K141 (= K418), Y167 (≠ F442), G168 (= G443), V170 (= V445)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
31% identity, 46% coverage: 273:551/606 of query aligns to 2:269/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G284), T15 (≠ G286), G16 (= G287), S17 (= S288), F18 (≠ I289), R40 (≠ E312), D41 (≠ F313), K44 (≠ Y316), D63 (≠ N337), V64 (= V338), A83 (= A359), A84 (= A360), A85 (= A361), K87 (= K363), L125 (≠ I402), S126 (= S403), K141 (= K418), Y167 (≠ F442), G168 (= G443), V170 (= V445), R174 (≠ S449)
- binding uridine-5'-diphosphate-glucose: K87 (= K363), T127 (= T404), K129 (= K406), Y137 (≠ M414), N169 (= N444), S176 (= S451), V177 (= V452), P193 (≠ T467), T195 (= T469), M199 (≠ I473), R201 (= R475), M235 (≠ I510), R254 (= R536), E257 (= E539)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
31% identity, 46% coverage: 273:551/606 of query aligns to 2:269/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G284), T15 (≠ G286), G16 (= G287), S17 (= S288), F18 (≠ I289), R40 (≠ E312), D41 (≠ F313), K44 (≠ Y316), D63 (≠ N337), V64 (= V338), A84 (= A360), A85 (= A361), K87 (= K363), S126 (= S403), Y137 (≠ M414), K141 (= K418), Y167 (≠ F442), G168 (= G443), V170 (= V445), S173 (= S448), R174 (≠ S449)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K363), D128 (= D405), K129 (= K406), N169 (= N444), G175 (= G450), S176 (= S451), V177 (= V452), P193 (≠ T467), I194 (≠ V468), M199 (≠ I473), R201 (= R475), M235 (≠ I510), R254 (= R536), E257 (= E539)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
31% identity, 46% coverage: 273:551/606 of query aligns to 2:269/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G284), T15 (≠ G286), G16 (= G287), S17 (= S288), F18 (≠ I289), S39 (= S311), R40 (≠ E312), D41 (≠ F313), K44 (≠ Y316), D63 (≠ N337), V64 (= V338), A83 (= A359), A84 (= A360), A85 (= A361), K87 (= K363), T102 (= T379), L125 (≠ I402), S126 (= S403), T127 (= T404), Y137 (≠ M414), K141 (= K418), Y167 (≠ F442), G168 (= G443), V170 (= V445), S173 (= S448), R174 (≠ S449)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K363), T127 (= T404), D128 (= D405), K129 (= K406), Y137 (≠ M414), N169 (= N444), S176 (= S451), V177 (= V452), P193 (≠ T467), T195 (= T469), M199 (≠ I473), R201 (= R475), M235 (≠ I510), R254 (= R536), E257 (= E539)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
31% identity, 46% coverage: 273:551/606 of query aligns to 6:273/333 of O25511
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
32% identity, 45% coverage: 280:551/606 of query aligns to 7:267/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G284), T13 (≠ G286), G14 (= G287), S15 (= S288), F16 (≠ I289), S37 (= S311), R38 (≠ E312), D39 (≠ F313), K42 (≠ Y316), D61 (≠ N337), V62 (= V338), A81 (= A359), A82 (= A360), A83 (= A361), K85 (= K363), T100 (= T379), L123 (≠ I402), S124 (= S403), K139 (= K418), Y165 (≠ F442), G166 (= G443), V168 (= V445), S171 (= S448), R172 (≠ S449)
- binding uridine-5'-diphosphate: K127 (= K406), N167 (= N444), V175 (= V452), P191 (≠ T467), I192 (≠ V468), T193 (= T469), M197 (≠ I473), R199 (= R475), M233 (≠ I510), R252 (= R536)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
29% identity, 42% coverage: 264:519/606 of query aligns to 17:271/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G287), S41 (= S288), I42 (= I289), D62 (= D309), I63 (≠ V310), D92 (≠ N337), I93 (≠ V338), L114 (≠ A359), S115 (≠ A360), A116 (= A361), K118 (= K363), V158 (≠ I402), D161 (= D405), K174 (= K418), V198 (= V445), S201 (= S448)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
27% identity, 46% coverage: 280:556/606 of query aligns to 8:256/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G284), S14 (≠ G286), G15 (= G287), S16 (= S288), L17 (≠ I289), R36 (≠ E312), D37 (≠ F313), D59 (≠ N337), I60 (≠ V338), A81 (= A359), A82 (= A360), A83 (= A361), K85 (= K363), V128 (= V400), Y140 (≠ M414), K144 (= K418), Y168 (≠ F442), G169 (= G443), V171 (= V445)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
28% identity, 37% coverage: 275:501/606 of query aligns to 1:198/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G284), T12 (≠ G286), G13 (= G287), S14 (= S288), F15 (≠ I289), S35 (vs. gap), R36 (vs. gap), D37 (vs. gap), K40 (≠ L318), D59 (≠ N337), V60 (= V338), A80 (= A360), A81 (= A361), K83 (= K363), L121 (≠ I402), T123 (= T404), K137 (= K418), Y163 (≠ F442), G164 (= G443)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
28% identity, 39% coverage: 264:500/606 of query aligns to 15:236/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G287), S39 (= S288), I40 (= I289), D60 (= D309), I61 (≠ V310), L89 (vs. gap), D90 (≠ N337), I91 (≠ V338), L112 (≠ A359), S113 (≠ A360), A114 (= A361), K116 (= K363), D159 (= D405), K172 (= K418), N195 (= N444), V196 (= V445), S199 (= S448)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
23% identity, 41% coverage: 280:526/606 of query aligns to 3:260/309 of 4zrnA
- active site: T117 (= T404), G119 (≠ K406), A120 (= A407), Y143 (≠ M414), K147 (= K418), Y181 (vs. gap), G185 (≠ S451)
- binding nicotinamide-adenine-dinucleotide: G7 (= G284), G10 (= G287), F11 (≠ S288), I12 (= I289), D31 (≠ V308), N32 (≠ D309), S34 (= S311), S35 (≠ E312), G36 (≠ F313), S51 (≠ N337), I52 (≠ V338), L73 (≠ A359), A74 (= A360), A75 (= A361), T92 (= T379), S115 (≠ I402), S116 (= S403), Y143 (≠ M414), K147 (= K418), Y170 (≠ F442), V173 (= V445)
- binding uridine-5'-diphosphate-glucose: T117 (= T404), G119 (≠ K406), A120 (= A407), Y143 (≠ M414), N172 (= N444), G185 (≠ S451), V186 (= V452), H201 (≠ T467), F203 (vs. gap), Y208 (≠ I473), R210 (= R475), V244 (≠ I510)
Sites not aligning to the query:
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
26% identity, 43% coverage: 280:539/606 of query aligns to 4:301/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G284), G11 (= G287), Y12 (≠ S288), I13 (= I289), D32 (= D309), N33 (vs. gap), N36 (vs. gap), D62 (≠ N337), L63 (≠ V338), F84 (≠ A359), A85 (= A360), G86 (≠ A361), K88 (= K363), N103 (= N372), S126 (≠ I402), S128 (≠ T404), Y152 (≠ M414), K156 (= K418), Y180 (≠ F442), P183 (≠ V445)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N444), N202 (vs. gap), L203 (vs. gap), T219 (= T467), Y221 (≠ T469), R234 (= R475), Y236 (≠ F477), V275 (≠ I510), R298 (= R536), D301 (≠ E539)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
26% identity, 43% coverage: 280:539/606 of query aligns to 4:301/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G284), G11 (= G287), Y12 (≠ S288), I13 (= I289), D32 (= D309), N33 (vs. gap), N36 (vs. gap), D62 (≠ N337), L63 (≠ V338), F84 (≠ A359), A85 (= A360), G86 (≠ A361), K88 (= K363), N103 (= N372), S126 (≠ I402), S128 (≠ T404), Y152 (≠ M414), K156 (= K418), Y180 (≠ F442), P183 (≠ V445)
- binding uridine-5'-diphosphate-glucose: S128 (≠ T404), A129 (vs. gap), F181 (≠ G443), N182 (= N444), N202 (vs. gap), L203 (vs. gap), T219 (= T467), V220 (= V468), Y221 (≠ T469), R234 (= R475), Y236 (≠ F477), V275 (≠ I510), R298 (= R536), D301 (≠ E539)
Query Sequence
>Ac3H11_1539 UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)
VLPNRTAVRLSSLVLLALDTALILLAWVLSFWLRFNLDVPDEFSSMAVESALLAVGSYWV
AFVGMGVHRQVWRYIGLSELRQLAIAVFLASLLTAAAVLMLRVPSFPRSVLLLHPLIVLM
LLVAARAAWRTLFERAVLPTGTRPILIVGALQDAADALRALKGSGHWHPVGIVSHLESEQ
GRSLQGVPVLGTTTNIDSIARSVDVRTALLASPAGSEGRSEVLKYSSDAGLALLAMPRPD
EWLRTESVGPRRIELEDLLGRVQVQLDAKGLSDLFAGTCVLVTGAGGSIGSELCRQIARF
GVARLVCVDVSEFAIYQLEQELREAHPQMQGMYYTANVREVERLHAIARLHQPTVVFHAA
AYKHVPLMESLNEIEALRTNVLGTMNVARVAAAIGAARFVLISTDKAVNPTNVMGASKRL
AERVMQAVASEHPGTRFVAVRFGNVLGSSGSVVPLFAEQIARGGPVTVTHPDIVRYFMTI
PEAAQLVLQAGLMGQSGQIFVLDMGEPVKIVELARILVRLSGKTEQEIPIVFTGLRPGEK
LYEELLANGETTEPTPHPKLHVAKTDASGGVNPEAVSQSIADLGVEPSASALRSWLQTQV
PEYTAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory