SitesBLAST
Comparing Ac3H11_1601 FitnessBrowser__acidovorax_3H11:Ac3H11_1601 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
29% identity, 96% coverage: 5:542/561 of query aligns to 3:551/590 of 7egvA
- active site: Y28 (≠ V30), G30 (= G32), G31 (≠ E33), A32 (≠ S34), I33 (≠ Y35), E54 (= E55), T77 (= T78), F116 (= F117), Q117 (= Q118), K166 (≠ E167), E220 (≠ R222), M256 (≠ L258), V283 (≠ P285), V400 (≠ A392), L425 (vs. gap), G426 (= G417), M428 (= M419), Q483 (≠ Y474), M485 (≠ T476), V486 (≠ I477), W489 (≠ H480), L511 (≠ Y502), G516 (= G507), I517 (≠ G508)
- binding flavin-adenine dinucleotide: R156 (= R157), G209 (= G212), Q210 (vs. gap), G211 (= G213), T236 (≠ S238), L237 (≠ F239), H238 (≠ R240), G276 (= G278), S277 (≠ G279), R278 (= R280), D280 (≠ S282), R282 (≠ V284), V283 (≠ P285), E309 (≠ H305), I310 (≠ A306), D328 (≠ T324), V329 (≠ F328), M405 (≠ T397), G423 (≠ T415), G424 (≠ S416)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (≠ E484), Y494 (= Y485)
- binding magnesium ion: D453 (= D444), N480 (= N471), E482 (≠ M473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (= P31), E54 (= E55), Q117 (= Q118), V400 (≠ A392), G401 (= G393), Q402 (≠ N394), H403 (≠ F395), G426 (= G417), M428 (= M419), D453 (= D444), A454 (≠ G445), S455 (≠ D446), E482 (≠ M473), Q483 (≠ Y474), G484 (= G475), M485 (≠ T476), V486 (≠ I477)
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
28% identity, 95% coverage: 10:542/561 of query aligns to 13:559/598 of 6desA
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), I38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), K229 (≠ R222), M265 (≠ L258), V292 (≠ P285), V408 (≠ A392), L433 (vs. gap), G434 (= G417), M436 (= M419), D461 (= D444), N488 (= N471), E490 (≠ M473), Q491 (≠ Y474), M493 (≠ T476), V494 (≠ I477), W497 (≠ H480), L519 (≠ Y502), N524 (≠ G507), V525 (≠ G508)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (≠ L258), D290 (≠ E283), R291 (≠ V284), W497 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G218 (= G212), A219 (vs. gap), G220 (= G213), N223 (≠ W216), T245 (≠ S238), L246 (≠ F239), Q247 (≠ R240), L263 (= L256), G285 (= G278), A286 (≠ G279), R287 (= R280), D289 (≠ S282), R291 (≠ V284), V292 (≠ P285), E318 (≠ H305), I319 (≠ A306), N323 (≠ E310), D337 (vs. gap), V338 (vs. gap), Q412 (≠ A396), M413 (≠ T397), G431 (≠ T415)
- binding magnesium ion: D461 (= D444), N488 (= N471), E490 (≠ M473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ A392), G409 (= G393), Q410 (≠ N394), H411 (≠ F395), G434 (= G417), M436 (= M419), G460 (= G443), D461 (= D444), A462 (≠ G445), S463 (≠ D446), N488 (= N471), E490 (≠ M473), Q491 (≠ Y474), G492 (= G475), M493 (≠ T476), V494 (≠ I477)
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
28% identity, 95% coverage: 10:542/561 of query aligns to 15:561/600 of 6derA
- active site: Y35 (≠ V30), G37 (= G32), G38 (≠ E33), A39 (≠ S34), I40 (≠ Y35), E61 (= E55), T84 (= T78), F123 (= F117), Q124 (= Q118), E125 (= E119), K173 (≠ E167), K231 (≠ R222), M267 (≠ L258), V294 (≠ P285), V410 (≠ A392), L435 (vs. gap), G436 (= G417), M438 (= M419), D463 (= D444), N490 (= N471), E492 (≠ M473), Q493 (≠ Y474), M495 (≠ T476), V496 (≠ I477), W499 (≠ H480), L521 (≠ Y502), N526 (≠ G507), V527 (≠ G508)
- binding flavin-adenine dinucleotide: R163 (= R157), G220 (= G212), A221 (vs. gap), G222 (= G213), N225 (≠ W216), T247 (≠ S238), L248 (≠ F239), Q249 (≠ R240), L265 (= L256), H268 (≠ G259), G287 (= G278), A288 (≠ G279), R289 (= R280), D291 (≠ S282), R293 (≠ V284), V294 (≠ P285), E320 (≠ H305), I321 (≠ A306), N325 (≠ E310), G338 (vs. gap), D339 (vs. gap), V340 (vs. gap), Q414 (≠ A396), M415 (≠ T397), G433 (≠ T415)
- binding Metosulam: R293 (≠ V284), M495 (≠ T476), W499 (≠ H480)
- binding magnesium ion: D463 (= D444), N490 (= N471), E492 (≠ M473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (≠ A392), G411 (= G393), Q412 (≠ N394), H413 (≠ F395), G436 (= G417), M438 (= M419), G462 (= G443), D463 (= D444), A464 (≠ G445), S465 (≠ D446), N490 (= N471), E492 (≠ M473), Q493 (≠ Y474), G494 (= G475), M495 (≠ T476), V496 (≠ I477)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (≠ A392), G411 (= G393), Q412 (≠ N394), H413 (≠ F395), G436 (= G417), M438 (= M419), G462 (= G443), D463 (= D444), A464 (≠ G445), S465 (≠ D446), M468 (= M449), N490 (= N471), E492 (≠ M473), Q493 (≠ Y474), G494 (= G475), V496 (≠ I477)
Sites not aligning to the query:
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
28% identity, 95% coverage: 10:542/561 of query aligns to 13:559/598 of 6depA
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), I38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), K229 (≠ R222), M265 (≠ L258), V292 (≠ P285), V408 (≠ A392), L433 (vs. gap), G434 (= G417), M436 (= M419), D461 (= D444), N488 (= N471), E490 (≠ M473), Q491 (≠ Y474), M493 (≠ T476), V494 (≠ I477), W497 (≠ H480), L519 (≠ Y502), N524 (≠ G507), V525 (≠ G508)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (≠ E283), R291 (≠ V284), M493 (≠ T476), W497 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G218 (= G212), A219 (vs. gap), G220 (= G213), N223 (≠ W216), T245 (≠ S238), L246 (≠ F239), Q247 (≠ R240), L263 (= L256), G264 (= G257), G285 (= G278), A286 (≠ G279), R287 (= R280), D289 (≠ S282), R291 (≠ V284), V292 (≠ P285), E318 (≠ H305), I319 (≠ A306), N323 (≠ E310), D337 (vs. gap), V338 (vs. gap), M413 (≠ T397), G431 (≠ T415)
- binding magnesium ion: D461 (= D444), N488 (= N471), E490 (≠ M473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (≠ A392), G409 (= G393), Q410 (≠ N394), H411 (≠ F395), G434 (= G417), M436 (= M419), G460 (= G443), D461 (= D444), A462 (≠ G445), S463 (≠ D446), M466 (= M449), N488 (= N471), E490 (≠ M473), Q491 (≠ Y474), G492 (= G475), M493 (≠ T476), V494 (≠ I477)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ A392), G409 (= G393), Q410 (≠ N394), H411 (≠ F395), G434 (= G417), M436 (= M419), G460 (= G443), D461 (= D444), A462 (≠ G445), S463 (≠ D446), M466 (= M449), N488 (= N471), E490 (≠ M473), Q491 (≠ Y474), G492 (= G475), M493 (≠ T476), V494 (≠ I477)
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
27% identity, 95% coverage: 10:542/561 of query aligns to 11:554/593 of 6deoA
- active site: Y31 (≠ V30), G33 (= G32), G34 (≠ E33), A35 (≠ S34), I36 (≠ Y35), E57 (= E55), T80 (= T78), F119 (= F117), Q120 (= Q118), E121 (= E119), K169 (≠ E167), K224 (≠ R222), M260 (≠ L258), V287 (≠ P285), V403 (≠ A392), L428 (vs. gap), G429 (= G417), M431 (= M419), D456 (= D444), N483 (= N471), E485 (≠ M473), Q486 (≠ Y474), M488 (≠ T476), V489 (≠ I477), W492 (≠ H480), L514 (≠ Y502), N519 (≠ G507), V520 (≠ G508)
- binding flavin-adenine dinucleotide: R159 (= R157), G213 (= G212), A214 (vs. gap), G215 (= G213), N218 (≠ W216), T240 (≠ S238), L241 (≠ F239), Q242 (≠ R240), L258 (= L256), G280 (= G278), A281 (≠ G279), R282 (= R280), D284 (≠ S282), R286 (≠ V284), V287 (≠ P285), E313 (≠ H305), I314 (≠ A306), N318 (≠ E310), D332 (vs. gap), V333 (vs. gap), M408 (≠ T397), G426 (≠ T415)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (≠ L258), D285 (≠ E283), R286 (≠ V284), M488 (≠ T476), W492 (≠ H480)
- binding magnesium ion: D456 (= D444), N483 (= N471), E485 (≠ M473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (≠ A392), G404 (= G393), Q405 (≠ N394), H406 (≠ F395), G429 (= G417), M431 (= M419), G455 (= G443), D456 (= D444), A457 (≠ G445), S458 (≠ D446), M461 (= M449), N483 (= N471), E485 (≠ M473), Q486 (≠ Y474), G487 (= G475), M488 (≠ T476), V489 (≠ I477)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
28% identity, 95% coverage: 10:542/561 of query aligns to 13:558/597 of 6demA
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), I38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), K228 (≠ R222), M264 (≠ L258), V291 (≠ P285), V407 (≠ A392), L432 (vs. gap), G433 (= G417), M435 (= M419), D460 (= D444), N487 (= N471), E489 (≠ M473), Q490 (≠ Y474), M492 (≠ T476), V493 (≠ I477), W496 (≠ H480), L518 (≠ Y502), N523 (≠ G507), V524 (≠ G508)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (≠ L258), D289 (≠ E283), R290 (≠ V284), M492 (≠ T476), W496 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G217 (= G212), A218 (vs. gap), G219 (= G213), N222 (≠ W216), T244 (≠ S238), L245 (≠ F239), Q246 (≠ R240), L262 (= L256), G284 (= G278), A285 (≠ G279), R286 (= R280), D288 (≠ S282), R290 (≠ V284), V291 (≠ P285), E317 (≠ H305), I318 (≠ A306), N322 (≠ E310), D336 (vs. gap), V337 (vs. gap), M412 (≠ T397), G430 (≠ T415)
- binding magnesium ion: D460 (= D444), N487 (= N471), E489 (≠ M473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A392), G408 (= G393), Q409 (≠ N394), H410 (≠ F395), M435 (= M419), G459 (= G443), D460 (= D444), A461 (≠ G445), S462 (≠ D446), M465 (= M449), N487 (= N471), E489 (≠ M473), Q490 (≠ Y474), G491 (= G475), M492 (≠ T476), V493 (≠ I477)
Sites not aligning to the query:
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
28% identity, 95% coverage: 10:542/561 of query aligns to 13:558/597 of 6delA
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), I38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), K228 (≠ R222), M264 (≠ L258), V291 (≠ P285), V407 (≠ A392), L432 (vs. gap), G433 (= G417), M435 (= M419), D460 (= D444), N487 (= N471), E489 (≠ M473), Q490 (≠ Y474), M492 (≠ T476), V493 (≠ I477), W496 (≠ H480), L518 (≠ Y502), N523 (≠ G507), V524 (≠ G508)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (≠ E283), R290 (≠ V284), W496 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G217 (= G212), A218 (vs. gap), G219 (= G213), N222 (≠ W216), T244 (≠ S238), L245 (≠ F239), Q246 (≠ R240), L262 (= L256), G284 (= G278), A285 (≠ G279), R286 (= R280), D288 (≠ S282), R290 (≠ V284), V291 (≠ P285), E317 (≠ H305), I318 (≠ A306), N322 (≠ E310), D336 (vs. gap), V337 (vs. gap), M412 (≠ T397), G430 (≠ T415)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A392), G408 (= G393), Q409 (≠ N394), H410 (≠ F395), G433 (= G417), M435 (= M419), G459 (= G443), D460 (= D444), A461 (≠ G445), S462 (≠ D446), M465 (= M449), N487 (= N471), E489 (≠ M473), Q490 (≠ Y474), G491 (= G475), M492 (≠ T476), V493 (≠ I477)
- binding magnesium ion: D460 (= D444), N487 (= N471), E489 (≠ M473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A392), G408 (= G393), Q409 (≠ N394), H410 (≠ F395), G433 (= G417), M435 (= M419), G459 (= G443), D460 (= D444), A461 (≠ G445), S462 (≠ D446), M465 (= M449), N487 (= N471), E489 (≠ M473), Q490 (≠ Y474), G491 (= G475), M492 (≠ T476), V493 (≠ I477)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
27% identity, 95% coverage: 10:542/561 of query aligns to 15:562/601 of 6deqA
- active site: Y35 (≠ V30), G37 (= G32), G38 (≠ E33), A39 (≠ S34), I40 (≠ Y35), E61 (= E55), T84 (= T78), F123 (= F117), Q124 (= Q118), E125 (= E119), K173 (≠ E167), K232 (≠ R222), M268 (≠ L258), V295 (≠ P285), V411 (≠ A392), L436 (vs. gap), G437 (= G417), M439 (= M419), D464 (= D444), N491 (= N471), E493 (≠ M473), Q494 (≠ Y474), M496 (≠ T476), V497 (≠ I477), W500 (≠ H480), L522 (≠ Y502), N527 (≠ G507), V528 (≠ G508)
- binding flavin-adenine dinucleotide: R163 (= R157), G221 (= G212), A222 (vs. gap), G223 (= G213), N226 (≠ W216), T248 (≠ S238), L249 (≠ F239), Q250 (≠ R240), L266 (= L256), G288 (= G278), A289 (≠ G279), R290 (= R280), D292 (≠ S282), R294 (≠ V284), V295 (≠ P285), E321 (≠ H305), I322 (≠ A306), D340 (vs. gap), V341 (vs. gap), M416 (≠ T397), G434 (≠ T415)
- binding magnesium ion: D464 (= D444), N491 (= N471), E493 (≠ M473)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (≠ L258), R294 (≠ V284), M496 (≠ T476), V497 (≠ I477), W500 (≠ H480)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (≠ A392), G412 (= G393), Q413 (≠ N394), H414 (≠ F395), M439 (= M419), G463 (= G443), D464 (= D444), A465 (≠ G445), S466 (≠ D446), N491 (= N471), E493 (≠ M473), Q494 (≠ Y474), G495 (= G475), M496 (≠ T476), V497 (≠ I477)
Sites not aligning to the query:
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
28% identity, 95% coverage: 10:542/561 of query aligns to 15:560/599 of 6denA
- active site: Y35 (≠ V30), G37 (= G32), G38 (≠ E33), A39 (≠ S34), I40 (≠ Y35), E61 (= E55), T84 (= T78), F123 (= F117), Q124 (= Q118), E125 (= E119), K173 (≠ E167), K230 (≠ R222), M266 (≠ L258), V293 (≠ P285), V409 (≠ A392), L434 (vs. gap), G435 (= G417), M437 (= M419), D462 (= D444), N489 (= N471), E491 (≠ M473), Q492 (≠ Y474), M494 (≠ T476), V495 (≠ I477), W498 (≠ H480), L520 (≠ Y502), N525 (≠ G507), V526 (≠ G508)
- binding flavin-adenine dinucleotide: R163 (= R157), G219 (= G212), A220 (vs. gap), G221 (= G213), N224 (≠ W216), T246 (≠ S238), L247 (≠ F239), Q248 (≠ R240), L264 (= L256), G286 (= G278), A287 (≠ G279), R288 (= R280), D290 (≠ S282), R292 (≠ V284), V293 (≠ P285), E319 (≠ H305), I320 (≠ A306), N324 (≠ E310), D338 (vs. gap), V339 (vs. gap), M414 (≠ T397), G432 (≠ T415)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (≠ L258), D291 (≠ E283), R292 (≠ V284), W498 (≠ H480)
- binding magnesium ion: D462 (= D444), N489 (= N471), E491 (≠ M473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (≠ A392), G410 (= G393), Q411 (≠ N394), H412 (≠ F395), G435 (= G417), M437 (= M419), G461 (= G443), D462 (= D444), A463 (≠ G445), S464 (≠ D446), N489 (= N471), E491 (≠ M473), Q492 (≠ Y474), G493 (= G475), M494 (≠ T476), V495 (≠ I477)
6wo1A Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
28% identity, 96% coverage: 10:546/561 of query aligns to 10:533/551 of 6wo1A
- active site: Y30 (≠ V30), G32 (= G32), G33 (≠ E33), A34 (≠ S34), I35 (≠ Y35), E56 (= E55), T79 (= T78), F118 (= F117), Q119 (= Q118), E120 (= E119), K168 (≠ E167), M255 (≠ L258), V282 (≠ P285), V398 (≠ A392), G424 (= G417), M426 (= M419), D451 (= D444), N478 (= N471)
- binding 2-methylpyrimidin-4-amine: G424 (= G417), T425 (≠ S418), M426 (= M419)
- binding diphosphate: V398 (≠ A392), G399 (= G393), Q400 (≠ N394), H401 (≠ F395), G450 (= G443), D451 (= D444), A452 (≠ G445), S453 (≠ D446)
- binding flavin-adenine dinucleotide: D97 (= D96), R158 (= R157), G208 (= G212), G210 (= G213), S213 (≠ W216), T235 (≠ S238), L236 (≠ F239), Q237 (≠ R240), I253 (≠ L256), G254 (= G257), M255 (≠ L258), G275 (= G278), V276 (≠ G279), R277 (= R280), D279 (≠ S282), R281 (≠ V284), V282 (≠ P285), E308 (≠ H305), I309 (≠ A306), D327 (≠ T324), V328 (≠ F328), Q402 (≠ A396), G421 (≠ T415), G422 (≠ S416)
- binding magnesium ion: D451 (= D444), N478 (= N471)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
29% identity, 95% coverage: 8:539/561 of query aligns to 90:635/664 of P09114
- P191 (≠ A108) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ H480) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
28% identity, 95% coverage: 8:539/561 of query aligns to 93:638/667 of P09342
- C161 (= C75) modified: Disulfide link with 307
- P194 (≠ A108) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (vs. gap) modified: Disulfide link with 161
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
28% identity, 92% coverage: 8:523/561 of query aligns to 11:540/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ L258), R292 (≠ V284), W489 (≠ H480)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A392), G401 (= G393), Q402 (≠ N394), H403 (≠ F395), G426 (= G417), M428 (= M419), G452 (= G443), D453 (= D444), G454 (= G445), S455 (≠ D446), L483 (≠ Y474), G484 (= G475), M485 (≠ T476), V486 (≠ I477)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G212), G223 (= G213), G224 (≠ S214), T246 (≠ S238), L247 (≠ F239), M248 (≠ R240), M263 (≠ D255), L264 (= L256), M266 (≠ L258), H267 (≠ G259), G286 (= G278), R288 (= R280), V293 (≠ P285), D310 (≠ H305), I311 (≠ A306), D329 (≠ T324), V330 (≠ P325), M405 (≠ T397), G423 (≠ T415)
- binding magnesium ion: A37 (≠ S34), T82 (= T78), S83 (≠ R79), Q122 (= Q118), Y381 (vs. gap), D453 (= D444), M458 (= M449), Q461 (= Q452), N480 (= N471), H482 (≠ M473), K533 (≠ T516)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
28% identity, 92% coverage: 8:523/561 of query aligns to 11:540/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A392), G401 (= G393), Q402 (≠ N394), H403 (≠ F395), G426 (= G417), M428 (= M419), G452 (= G443), D453 (= D444), G454 (= G445), S455 (≠ D446), M458 (= M449), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), G484 (= G475), M485 (≠ T476), V486 (≠ I477)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G212), G223 (= G213), G224 (≠ S214), T246 (≠ S238), L247 (≠ F239), M248 (≠ R240), L264 (= L256), M266 (≠ L258), H267 (≠ G259), G286 (= G278), V287 (≠ G279), R288 (= R280), D290 (≠ S282), R292 (≠ V284), V293 (≠ P285), D310 (≠ H305), I311 (≠ A306), D329 (≠ T324), V330 (≠ P325), M405 (≠ T397), G423 (≠ T415)
- binding magnesium ion: F370 (≠ L369), D453 (= D444), M458 (= M449), Q461 (= Q452), N480 (= N471), H482 (≠ M473), K533 (≠ T516)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ L258), R292 (≠ V284), M485 (≠ T476), W489 (≠ H480)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
28% identity, 92% coverage: 8:523/561 of query aligns to 11:540/582 of 5wj1A
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), S38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), M266 (≠ L258), V293 (≠ P285), V400 (≠ A392), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), M485 (≠ T476), V486 (≠ I477), W489 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G212), G223 (= G213), G224 (≠ S214), T246 (≠ S238), L247 (≠ F239), M248 (≠ R240), M263 (≠ D255), L264 (= L256), G286 (= G278), R288 (= R280), V293 (≠ P285), D310 (≠ H305), I311 (≠ A306), D329 (≠ T324), V330 (≠ P325), M405 (≠ T397), G423 (≠ T415), G424 (≠ S416)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ M473)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ L258), D291 (≠ E283), R292 (≠ V284), M485 (≠ T476), W489 (≠ H480)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A392), G401 (= G393), Q402 (≠ N394), H403 (≠ F395), M428 (= M419), D453 (= D444), G454 (= G445), S455 (≠ D446), M458 (= M449), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), G484 (= G475), M485 (≠ T476), V486 (≠ I477)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
28% identity, 92% coverage: 8:523/561 of query aligns to 11:540/582 of 5k6tA
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), S38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), M266 (≠ L258), V293 (≠ P285), V400 (≠ A392), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), M485 (≠ T476), V486 (≠ I477), W489 (≠ H480)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ G259), R292 (≠ V284), M485 (≠ T476), W489 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G212), G223 (= G213), G224 (≠ S214), T246 (≠ S238), L247 (≠ F239), M248 (≠ R240), L264 (= L256), G286 (= G278), R288 (= R280), D290 (≠ S282), R292 (≠ V284), V293 (≠ P285), D310 (≠ H305), I311 (≠ A306), D329 (≠ T324), V330 (≠ P325), Q404 (≠ A396), M405 (≠ T397), G423 (≠ T415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ M473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ A392), G401 (= G393), Q402 (≠ N394), H403 (≠ F395), G426 (= G417), M428 (= M419), G452 (= G443), G454 (= G445), S455 (≠ D446), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), G484 (= G475)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
28% identity, 92% coverage: 8:523/561 of query aligns to 11:540/582 of 5k6rA
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), S38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), M266 (≠ L258), V293 (≠ P285), V400 (≠ A392), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), M485 (≠ T476), V486 (≠ I477), W489 (≠ H480)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ V284), W489 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G212), G223 (= G213), G224 (≠ S214), T246 (≠ S238), L247 (≠ F239), M248 (≠ R240), L264 (= L256), M266 (≠ L258), G286 (= G278), R288 (= R280), R292 (≠ V284), V293 (≠ P285), D310 (≠ H305), I311 (≠ A306), G328 (≠ A323), D329 (≠ T324), V330 (≠ P325), M405 (≠ T397), G423 (≠ T415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ M473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ A392), G401 (= G393), Q402 (≠ N394), H403 (≠ F395), G426 (= G417), M428 (= M419), D453 (= D444), G454 (= G445), S455 (≠ D446), M458 (= M449), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), G484 (= G475), M485 (≠ T476), V486 (≠ I477)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
28% identity, 92% coverage: 8:523/561 of query aligns to 11:540/582 of 1z8nA
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), S38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), M266 (≠ L258), V293 (≠ P285), V400 (≠ A392), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), M485 (≠ T476), V486 (≠ I477), W489 (≠ H480)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K131), R161 (= R157), Y191 (≠ Q183), R194 (≠ E186), D291 (≠ E283), R292 (≠ V284), D312 (= D307), W489 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G212), G224 (≠ S214), T246 (≠ S238), L247 (≠ F239), M248 (≠ R240), L264 (= L256), G265 (= G257), M266 (≠ L258), H267 (≠ G259), G286 (= G278), V287 (≠ G279), R288 (= R280), D290 (≠ S282), R292 (≠ V284), V293 (≠ P285), D310 (≠ H305), I311 (≠ A306), D329 (≠ T324), V330 (≠ P325), M405 (≠ T397), G423 (≠ T415), G424 (≠ S416)
- binding magnesium ion: D453 (= D444), N480 (= N471)
- binding thiamine diphosphate: V400 (≠ A392), G401 (= G393), Q402 (≠ N394), H403 (≠ F395), G426 (= G417), M428 (= M419), G452 (= G443), G454 (= G445), S455 (≠ D446), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), G484 (= G475), M485 (≠ T476), V486 (≠ I477)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
28% identity, 92% coverage: 8:523/561 of query aligns to 11:540/582 of 1yi1A
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), S38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), M266 (≠ L258), V293 (≠ P285), V400 (≠ A392), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), M485 (≠ T476), V486 (≠ I477), W489 (≠ H480)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ E283), R292 (≠ V284), W489 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G223 (= G213), G224 (≠ S214), T246 (≠ S238), L247 (≠ F239), M248 (≠ R240), M263 (≠ D255), L264 (= L256), G265 (= G257), M266 (≠ L258), H267 (≠ G259), G286 (= G278), V287 (≠ G279), R288 (= R280), D290 (≠ S282), V293 (≠ P285), D310 (≠ H305), I311 (≠ A306), D329 (≠ T324), V330 (≠ P325), M405 (≠ T397), G423 (≠ T415), G424 (≠ S416)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ M473)
Sites not aligning to the query:
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
28% identity, 92% coverage: 8:523/561 of query aligns to 11:540/582 of 1yi0A
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), S38 (≠ Y35), E59 (= E55), T82 (= T78), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ E167), M266 (≠ L258), V293 (≠ P285), V400 (≠ A392), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ M473), L483 (≠ Y474), M485 (≠ T476), V486 (≠ I477), W489 (≠ H480)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ E283), R292 (≠ V284), W489 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G212), G223 (= G213), G224 (≠ S214), T246 (≠ S238), L247 (≠ F239), M248 (≠ R240), L264 (= L256), G265 (= G257), M266 (≠ L258), H267 (≠ G259), G286 (= G278), V287 (≠ G279), R288 (= R280), D290 (≠ S282), R292 (≠ V284), V293 (≠ P285), D310 (≠ H305), I311 (≠ A306), G328 (≠ A323), D329 (≠ T324), V330 (≠ P325), M405 (≠ T397), G423 (≠ T415), G424 (≠ S416)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ M473)
Sites not aligning to the query:
Query Sequence
>Ac3H11_1601 FitnessBrowser__acidovorax_3H11:Ac3H11_1601
MNTTSLTPRTGGQILVQQLITHGVKQLFCVPGESYLAVLDALHDADIGVTVCRQEGGAAM
MAEAQGKLTGQPGICFVTRGPGATNASAGVHIAHQDSTPMILFVGQVARGAMGREAFQEL
DYSAVFGTMAKWVVQIDDPARVPELISRAFHVATSGRPGPVVVALPEDMLTEAATVADAL
PYQVTETHPGAAQLAELAQRLQAAKNPVAILGGSRWSEEAVREFTAFAEAWSIPVYCSFR
RQMLFPATHACYGGDLGLGVNPKLLARIKASDLVLVVGGRLSEVPSQGYELFDIPTPAQS
FVHVHADADELGKLYRPTQAIHATPQAFTAALNAVRPTASVAWKAHTEAAHAEYLAWSDP
APIRIPGNLQMGEVMQHLKSVLPADTIFCNGAGNFATWVHRFWPFTTYASQLAPTSGSMG
YGLPAGVGGKRLWPQREVVVFAGDGDFLMHGQEFATAVQYGLPILVVLLDNAMYGTIRMH
QEREYPGRISATQLKNPDFKAYAQAFGGHGERVERTEDFAPALARARASGLPSVLHCLID
PEAITPTGTLQGIRKAALAKQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory