Comparing Ac3H11_2306 FitnessBrowser__acidovorax_3H11:Ac3H11_2306 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
49% identity, 99% coverage: 1:219/222 of query aligns to 3:212/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
49% identity, 99% coverage: 1:219/222 of query aligns to 1:210/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
49% identity, 99% coverage: 1:219/222 of query aligns to 1:210/212 of O86043
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
41% identity, 98% coverage: 3:219/222 of query aligns to 4:205/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
40% identity, 98% coverage: 3:219/222 of query aligns to 8:209/216 of O43708
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
39% identity, 99% coverage: 3:222/222 of query aligns to 8:212/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
39% identity, 99% coverage: 3:222/222 of query aligns to 5:209/212 of 2cz2A
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
42% identity, 99% coverage: 1:219/222 of query aligns to 8:211/220 of 4kaeA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
42% identity, 99% coverage: 1:219/222 of query aligns to 10:213/222 of 4kdyA
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
35% identity, 96% coverage: 1:213/222 of query aligns to 4:216/228 of 3n5oA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
35% identity, 96% coverage: 1:213/222 of query aligns to 6:218/231 of D2YW48
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
34% identity, 96% coverage: 1:214/222 of query aligns to 3:208/216 of 4pxoA
Q12390 Glutathione S-transferase 2; GST-II; EC 2.5.1.18 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
35% identity, 41% coverage: 14:104/222 of query aligns to 32:124/233 of Q12390
Sites not aligning to the query:
3ibhA Crystal structure of saccharomyces cerevisiae gtt2 in complex with glutathione (see paper)
35% identity, 41% coverage: 14:104/222 of query aligns to 14:106/208 of 3ibhA
Sites not aligning to the query:
3ergA Crystal structure of gtt2 from saccharomyces cerevisiae in complex with glutathione sulfnate (see paper)
35% identity, 41% coverage: 14:104/222 of query aligns to 14:106/208 of 3ergA
Sites not aligning to the query:
7zvpA Crystal structure of poplar glutathione transferase u19 in complex with glutathione (see paper)
31% identity, 46% coverage: 1:103/222 of query aligns to 3:102/216 of 7zvpA
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
28% identity, 55% coverage: 13:134/222 of query aligns to 15:141/219 of 3qawA
Sites not aligning to the query:
7dweA Crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione
33% identity, 44% coverage: 1:98/222 of query aligns to 3:97/212 of 7dweA
6f01B Arabidopsis thaliana gstf9, gso3 and gsoh bound (see paper)
35% identity, 42% coverage: 14:106/222 of query aligns to 14:107/212 of 6f01B
Sites not aligning to the query:
6ezyB Arabidopsis thaliana gstf9, gsh and gsoh bound (see paper)
35% identity, 42% coverage: 14:106/222 of query aligns to 14:107/212 of 6ezyB
Sites not aligning to the query:
>Ac3H11_2306 FitnessBrowser__acidovorax_3H11:Ac3H11_2306
MQLYNYFRSSASFRVRIALQIKGLAYDYLPVHLVKGEHKAPEYASRIGDALVPTLVTDGG
TALSQSMAIIEYLDETHPTPALLPATPLARARVRALAQMVACEIHPINNLRVLKYLVRDL
KVDEDAKNAWYRHWVRSGLEAFERQFALLAQERAAQGLAPSVLCWGDTPTLADCCLVPQI
FNGQRFNVNLDGLPLTMGAFEACMALPAFQQAQPSACPDFEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory