Comparing Ac3H11_2549 FitnessBrowser__acidovorax_3H11:Ac3H11_2549 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
53% identity, 96% coverage: 9:454/464 of query aligns to 3:444/450 of 3mduA
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
53% identity, 96% coverage: 9:454/464 of query aligns to 4:445/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
53% identity, 96% coverage: 9:454/464 of query aligns to 3:444/451 of 4rdvB
4f0lB Crystal structure of amidohydrolase from brucella melitensis
47% identity, 98% coverage: 6:462/464 of query aligns to 2:449/449 of 4f0lB
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
27% identity, 90% coverage: 32:450/464 of query aligns to 34:424/439 of 4dzhA
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
25% identity, 82% coverage: 53:434/464 of query aligns to 58:404/434 of 4f0sA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
25% identity, 82% coverage: 53:434/464 of query aligns to 58:404/436 of 4f0rA
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
25% identity, 77% coverage: 53:407/464 of query aligns to 58:395/452 of 8is4A
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
24% identity, 84% coverage: 53:442/464 of query aligns to 59:418/441 of 3lnpA
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
25% identity, 90% coverage: 32:447/464 of query aligns to 32:418/435 of 4gbdA
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
25% identity, 90% coverage: 32:447/464 of query aligns to 32:418/437 of 4dykA
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
22% identity, 75% coverage: 53:402/464 of query aligns to 58:399/474 of 4v1xE
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
22% identity, 75% coverage: 53:402/464 of query aligns to 58:399/474 of P72156
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
21% identity, 75% coverage: 53:402/464 of query aligns to 58:399/474 of Q9EYU0
6ohbA E. Coli guanine deaminase (see paper)
25% identity, 45% coverage: 190:399/464 of query aligns to 187:388/435 of 6ohbA
Sites not aligning to the query:
2imrA Crystal structure of amidohydrolase dr_0824 from deinococcus radiodurans
26% identity, 38% coverage: 206:381/464 of query aligns to 170:358/380 of 2imrA
Sites not aligning to the query:
2plmA Crystal structure of the protein tm0936 from thermotoga maritima complexed with zn and s-inosylhomocysteine (see paper)
24% identity, 48% coverage: 205:427/464 of query aligns to 167:364/404 of 2plmA
Sites not aligning to the query:
1p1mA Structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine
24% identity, 48% coverage: 205:427/464 of query aligns to 167:364/404 of 1p1mA
Sites not aligning to the query:
>Ac3H11_2549 FitnessBrowser__acidovorax_3H11:Ac3H11_2549
MSEPLQRQLFAADALLPTGWARDVLVAWDGAGRITAVTPNAQPNGAAVAPGPLLPGMPNL
HSHAFQRAFAGLTEYRGESQDSFWSWRNLMYRFAARITPESLEAIATWLYVEMLEAGYTS
VCEFHYVHHDQDGRPYADDATLSLALLRAAKSAGIGITLLPVLYQTSGFGAKPPRADQAR
FIRSTDNMLSLLERLAPATRALGGILGLAPHSLRAVPPDSLAAAVQGLTALNPQAPIHIH
IAEQTQEVEDCIAWSGQRPVQWLLEHAPVDERWCLVHATHMTPQEYADAARTGAVAGICP
TTEANLGDGIFDMPLWLQHGGRWGVGSDSHACVNAAEELLMLEYGQRLSLRQRNVLASRS
QAEVATAMTLQAVQGGAQASGRSVSGLAVGQQADLVALDARHVALAGLPAPSMLSSHVFG
SHRTSAIDSLWVAGVLRVAQGRHALHDAAAQAFVAARSTTIAAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory