Comparing Ac3H11_2944 FitnessBrowser__acidovorax_3H11:Ac3H11_2944 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
65% identity, 93% coverage: 33:443/443 of query aligns to 4:417/417 of 4ryaA
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
27% identity, 91% coverage: 33:434/443 of query aligns to 8:397/399 of 5iaiA
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
27% identity, 88% coverage: 37:424/443 of query aligns to 11:372/388 of 3k02A
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
27% identity, 88% coverage: 37:424/443 of query aligns to 11:372/388 of 3jzjA
6dtqA Maltose bound t. Maritima male3 (see paper)
25% identity, 88% coverage: 35:426/443 of query aligns to 4:381/391 of 6dtqA
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
24% identity, 74% coverage: 12:338/443 of query aligns to 10:335/416 of A9CEY9
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
24% identity, 87% coverage: 53:438/443 of query aligns to 27:407/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
24% identity, 92% coverage: 30:438/443 of query aligns to 44:448/450 of Q7LYW7
7qhvAAA Sulfoquinovosyl binding protein (see paper)
23% identity, 68% coverage: 38:338/443 of query aligns to 8:305/390 of 7qhvAAA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
23% identity, 68% coverage: 38:338/443 of query aligns to 6:302/382 of 7yzuA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
23% identity, 68% coverage: 38:338/443 of query aligns to 7:305/384 of 7yzsAAA
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
23% identity, 68% coverage: 38:338/443 of query aligns to 9:307/389 of 7ofyA
Sites not aligning to the query:
8artB Abc transporter binding protein male from streptomyces scabiei in complex with maltose
28% identity, 68% coverage: 49:348/443 of query aligns to 24:318/393 of 8artB
Sites not aligning to the query:
8s5bA Sulfoquinovosyl glycerol-binding protein SmoF (see paper)
23% identity, 66% coverage: 47:338/443 of query aligns to 12:297/377 of 8s5bA
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
23% identity, 81% coverage: 76:434/443 of query aligns to 49:389/393 of 5ci5A
Sites not aligning to the query:
5ysdA Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
26% identity, 39% coverage: 73:246/443 of query aligns to 42:212/387 of 5ysdA
Sites not aligning to the query:
5ysbA Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form (see paper)
26% identity, 39% coverage: 73:246/443 of query aligns to 41:211/386 of 5ysbA
Sites not aligning to the query:
5ysdB Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
26% identity, 39% coverage: 73:246/443 of query aligns to 42:212/389 of 5ysdB
Sites not aligning to the query:
6l0zA The crystal structure of salmonella enterica sugar-binding protein male
25% identity, 87% coverage: 46:429/443 of query aligns to 17:361/365 of 6l0zA
Sites not aligning to the query:
8g3yA Mbp-mcl1 in complex with ligand 34 (see paper)
25% identity, 75% coverage: 100:433/443 of query aligns to 71:367/515 of 8g3yA
Sites not aligning to the query:
>Ac3H11_2944 FitnessBrowser__acidovorax_3H11:Ac3H11_2944
MPRSTRPHTRLALAAAALAASLCGAAAHAQTELVIATVNNGHMIEMQKLSKNFEQAHPDI
KLKWVTLEEGVLRQRVTTDIATKGGQFDVMTIGMYEAPIWGKKGWLQELKTDAAYDVDDL
LPAVRNGLSIDGKLFAAPFYGESSMLMYRKDLADKAGVQVPERPTWPQIKDLAAKIHDPK
NGVYGICLRGKPGWGDNMAFLSTLVNTFGGQWFDMQWKPQLESKPWKEAITFYVDLLKNY
GPPGSSANSFNEILALTNSGKCGMWIDATIAASFVSDPKQSKVADQMAFAQAPTMNTPKG
ANWLWSWNLAIPAGSKKVDAAQKFITWSTSKEYVQLVAKTNGWANVPTGTRKSTYASPEF
QKAARFAAAEKVAIDSANPTDSTLPKSPYVGVQFAAIPEFQAIGIAVGQQMSAALAGKTT
VDAALKASQVSADREMKKAGYYK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory