Comparing Ac3H11_3317 FitnessBrowser__acidovorax_3H11:Ac3H11_3317 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
36% identity, 89% coverage: 15:203/213 of query aligns to 11:201/201 of 3m3mA
4gsnB Crystal structure of gste2 zan/u variant from anopheles gambiae (see paper)
32% identity, 90% coverage: 7:198/213 of query aligns to 3:195/220 of 4gsnB
2imkA Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity (see paper)
32% identity, 90% coverage: 7:198/213 of query aligns to 3:195/220 of 2imkA
Sites not aligning to the query:
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
33% identity, 90% coverage: 7:197/213 of query aligns to 2:194/206 of 4hz2B
3zmkB Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa (see paper)
31% identity, 91% coverage: 5:198/213 of query aligns to 4:198/222 of 3zmkB
5ft3B Aedes aegypti gste2
34% identity, 98% coverage: 5:212/213 of query aligns to 2:208/221 of 5ft3B
4pngB Glutathione s-transferase from drosophila melanogaster - isozyme e7 (see paper)
31% identity, 90% coverage: 7:198/213 of query aligns to 4:198/223 of 4pngB
1pn9A Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
28% identity, 90% coverage: 7:198/213 of query aligns to 1:193/209 of 1pn9A
Sites not aligning to the query:
6t2tA Crystal structure of drosophila melanogaster glutathione s-transferase epsilon 14 in complex with glutathione and 2-methyl-2,4-pentanediol (see paper)
33% identity, 83% coverage: 23:198/213 of query aligns to 19:195/229 of 6t2tA
Sites not aligning to the query:
1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
29% identity, 88% coverage: 7:193/213 of query aligns to 1:187/207 of 1jlvA
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
30% identity, 91% coverage: 6:198/213 of query aligns to 2:195/214 of 3wywB
7daxA Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp013-bound form
32% identity, 83% coverage: 23:198/213 of query aligns to 19:195/224 of 7daxA
Sites not aligning to the query:
7db3A Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp011-bound form
32% identity, 83% coverage: 23:198/213 of query aligns to 19:195/223 of 7db3A
Sites not aligning to the query:
7db4A Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp012- and glutathione-bound form
32% identity, 83% coverage: 23:198/213 of query aligns to 19:195/225 of 7db4A
Sites not aligning to the query:
7dazA Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp015- and gsh-bound form
32% identity, 83% coverage: 23:198/213 of query aligns to 19:195/219 of 7dazA
Sites not aligning to the query:
6keoAA Glutathione S-transferase E14 (see paper)
32% identity, 83% coverage: 23:198/213 of query aligns to 19:195/225 of 6keoAA
Sites not aligning to the query:
3vwxC Structural analysis of an epsilon-class glutathione s-transferase from housefly, musca domestica (see paper)
30% identity, 83% coverage: 23:198/213 of query aligns to 18:196/220 of 3vwxC
Sites not aligning to the query:
7db0A Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in dimedone-bound form
32% identity, 83% coverage: 23:198/213 of query aligns to 20:196/225 of 7db0A
Sites not aligning to the query:
4mpgB Crystal structure of human glutathione transferase theta-2, complex with glutathione and unknown ligand, target efi-507257
30% identity, 79% coverage: 29:197/213 of query aligns to 33:210/252 of 4mpgB
Sites not aligning to the query:
8ai8A Crystal structure of glutathione transferase chi 1 from synechocystis sp. Pcc 6803 in complex with glutathione (see paper)
33% identity, 90% coverage: 7:198/213 of query aligns to 2:177/183 of 8ai8A
>Ac3H11_3317 FitnessBrowser__acidovorax_3H11:Ac3H11_3317
MVPTTPLQLYRMPISGHCHRVELMLCLLGLPYELIDVNLLRGEHQRAEFLALNPLGQVPV
LVDAGQVLSDSNGILVYLVQRYAPGSAWLPQDAVGQAQLQRWFSLAAGFLAPGIGGPRFA
TLNGRAVNEVAQATGKRLLAFMEDELQGRAWLLGGPAPSLADVAMVSYTSQAHLAGLPLD
AYPRIAAWVARMQALPGYPVLADQLPTAEQVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory