Comparing Ac3H11_3348 FitnessBrowser__acidovorax_3H11:Ac3H11_3348 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
54% identity, 98% coverage: 1:181/184 of query aligns to 28:208/210 of 2xf4A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
36% identity, 99% coverage: 1:183/184 of query aligns to 26:209/209 of 7ev5A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
39% identity, 99% coverage: 1:183/184 of query aligns to 26:202/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
39% identity, 98% coverage: 1:181/184 of query aligns to 24:198/198 of 2zziA
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
32% identity, 99% coverage: 1:183/184 of query aligns to 27:202/202 of 7l0bA
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
31% identity, 99% coverage: 1:183/184 of query aligns to 28:192/225 of 4ysbA
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
34% identity, 97% coverage: 1:179/184 of query aligns to 32:201/244 of 2gcuA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 97% coverage: 1:179/184 of query aligns to 81:250/294 of Q9C8L4
6sg9FL uS3m (see paper)
28% identity, 86% coverage: 20:178/184 of query aligns to 99:294/320 of 6sg9FL
Sites not aligning to the query:
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
32% identity, 91% coverage: 15:181/184 of query aligns to 65:215/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
33% identity, 90% coverage: 15:179/184 of query aligns to 49:197/237 of 4chlB
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
31% identity, 93% coverage: 13:183/184 of query aligns to 44:198/350 of 5ve5A
Sites not aligning to the query:
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
29% identity, 97% coverage: 1:179/184 of query aligns to 30:212/473 of 3tp9A
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
28% identity, 97% coverage: 1:178/184 of query aligns to 32:210/336 of 3r2uB
Sites not aligning to the query:
6aufB Crystal structure of metalo beta lactamases mim-1 from novosphingobium pentaromativorans
28% identity, 98% coverage: 4:183/184 of query aligns to 56:247/273 of 6aufB
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
28% identity, 90% coverage: 1:165/184 of query aligns to 27:169/254 of 2q42A
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 90% coverage: 1:165/184 of query aligns to 97:239/324 of Q9SID3
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
27% identity, 97% coverage: 1:178/184 of query aligns to 30:222/348 of 3r2uA
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
30% identity, 94% coverage: 9:181/184 of query aligns to 52:238/295 of 4efzA
4ad9A Crystal structure of human lactb2. (see paper)
26% identity, 87% coverage: 8:167/184 of query aligns to 56:201/288 of 4ad9A
>Ac3H11_3348 FitnessBrowser__acidovorax_3H11:Ac3H11_3348
VIDPGGDLDVLLAEIQRLGLTLSQIWLTHAHIDHAGGTGELATRLGLPIVGPHPGDQFWI
DGLPQQSAMFGFPPAQHFTPTRWLADGDTVQIGDETLAVRHCPGHTPGHVVFHAPQIDRA
FVGDVLFAGSIGRTDFPMGNHQDLIDSITQRLWPMGDQTVFIPGHGPESTFGRERKSNPY
VGGT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory