SitesBLAST
Comparing Ac3H11_3400 FitnessBrowser__acidovorax_3H11:Ac3H11_3400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
29% identity, 50% coverage: 4:189/375 of query aligns to 53:236/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I24), G75 (= G26), S76 (≠ G27), G77 (= G28), T78 (= T29), G79 (= G34), L80 (= L35), A83 (vs. gap), C84 (vs. gap), P137 (= P86), G138 (≠ P87), E139 (≠ H88), A142 (= A97), T143 (= T98), G146 (= G101), N147 (≠ M102), S149 (≠ A104), T150 (≠ A105), A152 (≠ L107), G153 (≠ S108), E203 (≠ W158), G204 (= G159), I209 (≠ L164)
Sites not aligning to the query:
O00116 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Aging-associated gene 5 protein; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Homo sapiens (Human) (see 2 papers)
30% identity, 40% coverage: 26:174/375 of query aligns to 236:384/658 of O00116
Sites not aligning to the query:
- 182 R → Q: in RCDP3; severely reduced protein levels
- 419 Important for enzyme activity; R → H: in RCDP3; loss of enzyme activity; dbSNP:rs121434411
- 471 E → K: in RCDP3; severely reduced protein levels
- 568 T → M: in RCDP3; does not affect protein levels; dbSNP:rs387907214
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
25% identity, 93% coverage: 25:371/375 of query aligns to 70:464/465 of 3pm9A
- active site: A149 (≠ L107), L159 (≠ A117)
- binding flavin-adenine dinucleotide: Q70 (≠ R25), G71 (= G26), G72 (= G27), N73 (≠ G28), T74 (= T29), G75 (≠ K30), L76 (≠ D31), G79 (= G34), Q80 (≠ L35), L91 (≠ T44), L133 (≠ K91), G134 (≠ T92), A135 (≠ P93), C139 (≠ A97), T140 (= T98), G142 (= G100), G143 (= G101), S146 (≠ A104), T147 (≠ A105), A149 (≠ L107), G150 (≠ S108), E200 (≠ W158), G201 (= G159), I205 (≠ L163), I206 (≠ L164), E423 (≠ A330)
Sites not aligning to the query:
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 156:303/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ P87)
- binding flavin-adenine dinucleotide: G156 (= G26), G157 (= G27), G158 (= G28), T159 (= T29), S160 (≠ K30), V161 (≠ D31), G164 (= G34), P222 (= P86), D223 (≠ P87), S224 (≠ H88), S228 (≠ A97), T229 (= T98), G232 (= G101), W233 (≠ M102), S235 (≠ A104), T236 (≠ A105), A238 (≠ L107), S239 (= S108), E288 (≠ W158), V293 (≠ L163), I294 (≠ L164)
Sites not aligning to the query:
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: 411, 421, 422, 423, 474, 476, 478
- binding flavin-adenine dinucleotide: 16, 154, 155, 512
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
29% identity, 40% coverage: 26:174/375 of query aligns to 236:384/658 of P97275
- H300 (≠ F84) mutation to A: Loss of activity.
- 303:309 (vs. 87:98, 8% identical) binding
- T309 (= T98) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ AGLS 105:108) binding
- S367 (≠ A157) mutation to A: Strongly reduced activity.
- 368:374 (vs. 158:164, 57% identical) binding
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 234:240 binding
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding ; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 142:289/542 of 4bc9B
- binding propanenitrile: D209 (≠ P87)
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), V147 (≠ D31), G150 (= G34), L151 (= L35), P208 (= P86), D209 (≠ P87), S210 (≠ H88), S214 (≠ A97), T215 (= T98), G218 (= G101), W219 (≠ M102), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ W158), G275 (= G159), I280 (≠ L164)
Sites not aligning to the query:
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 156:303/557 of 5adzC
- binding flavin-adenine dinucleotide: G156 (= G26), G157 (= G27), G158 (= G28), T159 (= T29), S160 (≠ K30), P222 (= P86), D223 (≠ P87), S224 (≠ H88), S228 (≠ A97), T229 (= T98), G232 (= G101), W233 (≠ M102), S235 (≠ A104), T236 (≠ A105), A238 (≠ L107), S239 (= S108), E288 (≠ W158), G289 (= G159), I294 (≠ L164)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ P87)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 154, 155, 515
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 410, 414, 424, 425, 426, 477, 515, 516
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 142:289/539 of 5ae1B
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), G150 (= G34), L151 (= L35), P208 (= P86), D209 (≠ P87), S210 (≠ H88), S214 (≠ A97), T215 (= T98), G218 (= G101), W219 (≠ M102), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ W158), V279 (≠ L163), I280 (≠ L164)
Sites not aligning to the query:
- binding (3-(2-fluorophenyl)-n-(1-(2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)ethyl)butanamide): 392, 396, 406, 407, 408, 459, 497
- binding flavin-adenine dinucleotide: 16, 140, 141, 497, 535
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 142:289/542 of 5ae2B
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), G150 (= G34), L151 (= L35), P208 (= P86), D209 (≠ P87), S210 (≠ H88), S214 (≠ A97), T215 (= T98), G218 (= G101), W219 (≠ M102), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ W158), G275 (= G159), V279 (≠ L163), I280 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 140, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 142:289/543 of 4bc7B
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), V147 (≠ D31), G150 (= G34), L151 (= L35), P208 (= P86), D209 (≠ P87), S210 (≠ H88), S214 (≠ A97), T215 (= T98), G218 (= G101), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ W158), G275 (= G159), I280 (≠ L164)
Sites not aligning to the query:
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 142:289/539 of 5ae3A
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), V147 (≠ D31), L151 (= L35), P208 (= P86), D209 (≠ P87), S210 (≠ H88), S214 (≠ A97), T215 (= T98), G218 (= G101), W219 (≠ M102), S221 (≠ A104), T222 (≠ A105), A224 (≠ L107), S225 (= S108), E274 (≠ W158), V279 (≠ L163), I280 (≠ L164)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 140, 141, 497
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 147:294/555 of 4bc9A
- binding propanenitrile: D214 (≠ P87)
- binding flavin-adenine dinucleotide: G147 (= G26), G148 (= G27), G149 (= G28), T150 (= T29), S151 (≠ K30), V152 (≠ D31), G155 (= G34), L156 (= L35), P213 (= P86), D214 (≠ P87), S215 (≠ H88), S219 (≠ A97), T220 (= T98), G223 (= G101), W224 (≠ M102), S226 (≠ A104), T227 (≠ A105), A229 (≠ L107), S230 (= S108), E279 (≠ W158), V284 (≠ L163), I285 (≠ L164)
Sites not aligning to the query:
5ae2A Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 147:294/561 of 5ae2A
- binding flavin-adenine dinucleotide: G147 (= G26), G148 (= G27), G149 (= G28), T150 (= T29), S151 (≠ K30), G155 (= G34), L156 (= L35), P213 (= P86), D214 (≠ P87), S215 (≠ H88), S219 (≠ A97), T220 (= T98), G223 (= G101), W224 (≠ M102), S226 (≠ A104), T227 (≠ A105), A229 (≠ L107), S230 (= S108), E279 (≠ W158), V284 (≠ L163), I285 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 145, 146, 519
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 415, 418, 428, 429, 430, 481, 483, 519
5ae1A Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 141:288/560 of 5ae1A
- binding flavin-adenine dinucleotide: G141 (= G26), G142 (= G27), G143 (= G28), T144 (= T29), S145 (≠ K30), V146 (≠ D31), G149 (= G34), L150 (= L35), P207 (= P86), D208 (≠ P87), S209 (≠ H88), S213 (≠ A97), T214 (= T98), G216 (= G100), G217 (= G101), W218 (≠ M102), S220 (≠ A104), T221 (≠ A105), A223 (≠ L107), S224 (= S108), E273 (≠ W158), G274 (= G159), V278 (≠ L163), I279 (≠ L164)
Sites not aligning to the query:
5adzA Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
29% identity, 39% coverage: 26:173/375 of query aligns to 144:291/566 of 5adzA
- binding flavin-adenine dinucleotide: G144 (= G26), G145 (= G27), G146 (= G28), T147 (= T29), S148 (≠ K30), G152 (= G34), P210 (= P86), D211 (≠ P87), S212 (≠ H88), S216 (≠ A97), T217 (= T98), G220 (= G101), W221 (≠ M102), S223 (≠ A104), T224 (≠ A105), A226 (≠ L107), S227 (= S108), E276 (≠ W158), G277 (= G159), V281 (≠ L163), I282 (≠ L164)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D211 (≠ P87)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 142, 143, 524
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 423, 433, 434, 435, 486, 488, 489, 524, 525
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 44% coverage: 8:173/375 of query aligns to 52:213/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
23% identity, 89% coverage: 39:371/375 of query aligns to 85:454/455 of 8jdpA
- binding flavin-adenine dinucleotide: L90 (≠ T44), P132 (= P86), G133 (≠ S94), A134 (≠ D95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ W158), G201 (= G159), I206 (≠ L164), H369 (vs. gap), E413 (≠ T336), N450 (= N367)
- binding deaminohydroxyvaline: R319 (vs. gap), H414 (≠ G337)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
23% identity, 89% coverage: 39:371/375 of query aligns to 85:454/455 of 8jdxA
- binding flavin-adenine dinucleotide: L90 (≠ T44), P132 (= P86), G133 (≠ S94), A134 (≠ D95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ W158), G201 (= G159), I206 (≠ L164), W322 (= W261), E413 (≠ T336), H414 (≠ G337), N450 (= N367)
- binding 3-methyl-2-oxobutanoic acid: R318 (vs. gap), H369 (vs. gap), H376 (vs. gap), H414 (≠ G337)
- binding manganese (ii) ion: H369 (vs. gap), H376 (vs. gap), E413 (≠ T336)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
22% identity, 89% coverage: 39:371/375 of query aligns to 85:455/456 of 8jdrA
- binding flavin-adenine dinucleotide: L90 (≠ T44), P132 (= P86), G133 (≠ S94), A134 (≠ D95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ W158), G201 (= G159), I206 (≠ L164), Y324 (≠ F262), H370 (vs. gap), E414 (≠ T336), N451 (= N367)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (vs. gap), W323 (= W261), H415 (≠ G337)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
22% identity, 89% coverage: 39:371/375 of query aligns to 85:455/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (vs. gap), W323 (= W261), H370 (vs. gap), H415 (≠ G337)
- binding flavin-adenine dinucleotide: L90 (≠ T44), P132 (= P86), G133 (≠ S94), A134 (≠ D95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ W158), G201 (= G159), I206 (≠ L164), H370 (vs. gap), E414 (≠ T336), N451 (= N367)
Sites not aligning to the query:
Query Sequence
>Ac3H11_3400 FitnessBrowser__acidovorax_3H11:Ac3H11_3400
MDFSLAPIAERVRAAAADQTPLRIRGGGTKDFHGLALHGEVLDTRGLRGIVSYEPSELVV
TVRAGTPLAELEALLAEKGQCLPFEPPHFAKTPSDAATVGGMVAAGLSGPARASVGAVRD
YLLGVTVLNGKGELLTFGGQVMKNVAGYDVSRLMAGAWGTLGLLTEVSLKVLPVAPGEAT
LRFDDITQANALRQLHAWGGQPLPLNASCWVQDGGVGTLYVRLRGAVAAVEAACKTMGGT
RMDNATVAADWTACREQTLPWFADRAQRPDHALWRLSVPATAPVLALPGGAEPLVEWHGA
LRWVQAPESAGEALREAAQAVGGNASVFVAASAGGTGAKGLFDLKSTALEQIHTRLKHSF
DPAGIFNPGRVARAW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory