SitesBLAST
Comparing Ac3H11_3592 FitnessBrowser__acidovorax_3H11:Ac3H11_3592 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
41% identity, 77% coverage: 4:205/263 of query aligns to 6:222/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (= K24), L30 (= L25), A32 (= A27), G33 (= G28), G34 (= G29), H35 (≠ Q30), S36 (= S31), L37 (= L32), I54 (≠ L49), I101 (= I96), A102 (≠ G97), G110 (= G105), T111 (= T106), G114 (= G109), D115 (≠ S110), A117 (= A112), N123 (≠ A118), D124 (≠ C119), L161 (= L152), V166 (≠ I157), M167 (≠ I158), W193 (≠ F181)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
34% identity, 98% coverage: 3:260/263 of query aligns to 5:281/287 of 1n5wC
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
34% identity, 98% coverage: 3:260/263 of query aligns to 5:281/288 of P19920
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
32% identity, 98% coverage: 1:258/263 of query aligns to 1:269/274 of 4zohB
- active site: Y256 (= Y245)
- binding flavin-adenine dinucleotide: R28 (≠ K24), P29 (≠ L25), A31 (= A27), G32 (= G28), G33 (= G29), H34 (≠ Q30), S35 (= S31), L36 (= L32), H77 (= H73), I95 (= I96), G96 (= G97), V100 (= V101), T105 (= T106), G108 (= G109), S109 (= S110), S111 (≠ A112), A117 (= A118), D118 (≠ C119), L160 (≠ I157), V161 (≠ I158), D185 (≠ R180), F186 (= F181)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
33% identity, 98% coverage: 3:260/263 of query aligns to 5:278/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ L25), A31 (= A27), G32 (= G28), G33 (= G29), Q34 (= Q30), S35 (= S31), L36 (= L32), V100 (≠ I96), A101 (≠ G97), V105 (= V101), T110 (= T106), G113 (= G109), S114 (= S110), A116 (= A112), A122 (= A118), E123 (≠ C119), L166 (≠ I158), Y190 (≠ F181)
7dqxE Crystal structure of xanthine dehydrogenase family protein
31% identity, 99% coverage: 3:262/263 of query aligns to 5:284/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (= K24), I30 (≠ L25), I31 (≠ L26), G33 (= G28), G34 (= G29), Q35 (= Q30), S36 (= S31), L37 (= L32), H78 (= H73), I101 (= I96), A102 (≠ G97), I106 (≠ V101), G110 (= G105), T111 (= T106), G113 (= G108), G114 (= G109), S115 (= S110), A117 (= A112), A123 (= A118), E124 (≠ C119), I167 (= I158), Y193 (≠ F181)
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
29% identity, 74% coverage: 1:195/263 of query aligns to 1:212/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (≠ L25), A31 (= A27), G32 (= G28), G33 (= G29), T34 (≠ Q30), D35 (≠ S31), F77 (≠ H73), V100 (≠ I96), G101 (= G97), I105 (≠ V101), T110 (= T106), G113 (= G109), N114 (≠ S110), S116 (≠ A112), T117 (≠ N113), G122 (≠ A118), D123 (≠ C119), I168 (= I157), M169 (≠ I158)
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
29% identity, 74% coverage: 1:195/263 of query aligns to 1:212/296 of Q0QLF4
- 29:36 (vs. 25:32, 50% identical) binding
- G101 (= G97) binding
- TIGGN 110:114 (≠ TLGGS 106:110) binding
- D123 (≠ C119) binding
- R160 (≠ T149) binding
- M169 (≠ I158) binding
- K187 (≠ Q176) binding
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
30% identity, 99% coverage: 3:263/263 of query aligns to 163:440/450 of 1jroA
- binding flavin-adenine dinucleotide: L189 (= L25), A191 (= A27), G192 (= G28), G193 (= G29), T194 (≠ Q30), D195 (≠ S31), V196 (≠ L32), F258 (≠ I96), A259 (≠ G97), T268 (= T106), G271 (= G109), N272 (≠ S110), A274 (= A112), G280 (≠ A118), D281 (≠ C119), R318 (≠ L152), V324 (≠ I158)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 43
- binding fe2/s2 (inorganic) cluster: 37, 38, 39, 40, 42, 44, 45, 47, 63, 103, 106, 134, 136
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
30% identity, 99% coverage: 3:263/263 of query aligns to 163:440/450 of 2w54A
- binding flavin-adenine dinucleotide: L189 (= L25), A191 (= A27), G192 (= G28), G193 (= G29), T194 (≠ Q30), D195 (≠ S31), V196 (≠ L32), W199 (≠ S35), L213 (= L49), F258 (≠ I96), A259 (≠ G97), A267 (≠ G105), T268 (= T106), G271 (= G109), N272 (≠ S110), A274 (= A112), N275 (= N113), G280 (≠ A118), D281 (≠ C119), R318 (≠ L152), V324 (≠ I158), Q347 (vs. gap)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 63, 103, 104, 106, 134, 135, 136
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 102, 136
5g5gB Escherichia coli periplasmic aldehyde oxidase (see paper)
30% identity, 83% coverage: 1:218/263 of query aligns to 1:277/316 of 5g5gB
- binding flavin-adenine dinucleotide: K26 (= K24), F27 (≠ L25), A29 (= A27), G30 (= G28), G31 (= G29), T32 (≠ Q30), N33 (≠ S31), L34 (= L32), G98 (≠ A94), A99 (≠ H95), L103 (≠ V101), A107 (≠ G105), T108 (= T106), A110 (≠ G108), G111 (= G109), N112 (≠ S110), L114 (≠ A112), Q115 (≠ N113), S163 (= S122), D164 (vs. gap), L212 (≠ I157), I213 (= I158), F239 (= F181)
- binding iron/sulfur cluster: C119 (vs. gap), C129 (≠ A117), N130 (vs. gap), K131 (vs. gap), C138 (vs. gap), H148 (vs. gap), C157 (= C119), I158 (vs. gap), A159 (vs. gap)
P77324 Aldehyde oxidoreductase FAD-binding subunit PaoB; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
30% identity, 83% coverage: 1:218/263 of query aligns to 1:277/318 of P77324
- 26:34 (vs. 24:32, 56% identical) binding
- T108 (= T106) binding
- C119 (vs. gap) binding
- C129 (≠ A117) binding
- C138 (vs. gap) binding
- C157 (= C119) binding
- D164 (vs. gap) binding
- I213 (= I158) binding
- K230 (= K173) binding
5y6qB Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
26% identity, 84% coverage: 1:221/263 of query aligns to 1:287/330 of 5y6qB
- binding flavin-adenine dinucleotide: I26 (≠ L25), A28 (= A27), G29 (= G28), G30 (= G29), T31 (≠ Q30), T32 (≠ S31), Q33 (≠ L32), A97 (≠ I96), A98 (≠ G97), I102 (≠ V101), A106 (≠ G105), T107 (= T106), G110 (= G109), N111 (≠ S110), R113 (≠ A112), Q114 (≠ N113), G164 (≠ S122), D165 (vs. gap), I213 (= I157), I214 (= I158), K232 (= K173), F241 (vs. gap)
- binding iron/sulfur cluster: C118 (vs. gap), Y121 (vs. gap), C130 (= C119), N131 (vs. gap), C139 (vs. gap), A141 (vs. gap), C158 (vs. gap), I159 (vs. gap), A160 (vs. gap)
1rm6B Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
29% identity, 76% coverage: 4:202/263 of query aligns to 7:259/323 of 1rm6B
- binding flavin-adenine dinucleotide: P29 (vs. gap), G31 (≠ A27), A32 (≠ G28), G33 (= G29), T34 (≠ Q30), D35 (≠ S31), L36 (= L32), L53 (= L49), V101 (≠ I96), A102 (≠ G97), A110 (≠ G105), T111 (= T106), G114 (= G109), N115 (≠ S110), C117 (≠ A112), Q118 (≠ N113), D162 (vs. gap), L207 (≠ I158), V231 (≠ S179), D232 (≠ R180), F233 (= F181)
- binding iron/sulfur cluster: C122 (≠ A117), F124 (vs. gap), C138 (vs. gap), C146 (vs. gap), H147 (vs. gap), V148 (vs. gap), C155 (= C119), Y156 (= Y120), A157 (≠ P121)
O33820 4-hydroxybenzoyl-CoA reductase subunit beta; 4-HBCR subunit beta; EC 1.1.7.1 from Thauera aromatica (see paper)
29% identity, 76% coverage: 4:202/263 of query aligns to 7:259/324 of O33820
- 29:36 (vs. 26:32, 38% identical) binding
- T111 (= T106) binding
- N115 (≠ S110) binding
- Q118 (≠ N113) binding
- D162 (vs. gap) binding
- K224 (= K173) binding
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 70% coverage: 23:207/263 of query aligns to 283:478/1361 of Q8GUQ8
- W364 (≠ H95) mutation to A: Decreases activity 8-fold.
- Y421 (≠ M147) mutation to A: Decreases activity 4-fold.
Sites not aligning to the query:
- 831 E→A: Loss of activity.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
Query Sequence
>Ac3H11_3592 FitnessBrowser__acidovorax_3H11:Ac3H11_3592
MYAFTFEAPTSVAAAAQHIAQGGKLLAGGQSLLPSMRLRLANPEKIVDLNGVAELAGIRR
DGNALVIGAMTRHMDVASSADVKAAIPALADLAAHIGDRQVRARGTLGGSVANNDPAACY
PSAVLGLGATVITNKREIAADDFFVGMYTTALEEGEIITAIRFPIPQRAAYMKFKQPASR
FSLVGVFVAQTDSGVRVAITGAATSVFRHAGLEAALSQSFTAAAAAGVTIDASDLNSDIH
ASAAYRANLISVQTQRAVQKMLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory