SitesBLAST – Find functional sites

 

SitesBLAST

Comparing Ac3H11_3802 FitnessBrowser__acidovorax_3H11:Ac3H11_3802 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
35% identity, 79% coverage: 6:166/205 of query aligns to 7:156/205 of P18776

query
sites
P18776
F
 
F
I
 
F
C
 
I
D
 
D
A
 
S
E
 
S
R
 
R
C
 
C
I
 
T
E
 
G
C
 
C
N
 
K
G
 
T
C
 
C
V
 
E
T
 
L
A
 
A
C
 
C
K
 
K
N
 
D
E
 
Y
H
 
K
E
 
D
V
 
L
P
 
T
W
 
P
G
 
E
V
 
V
N
 
S
R
 
F
R
 
R
R
 
R
V
 
I
V
 
Y
T
 
E
L
 
Y
N
 
A
D
 
G
G
 
G
V
 
D
P
 
W
G
 
Q
E
 
E
K
 
D
S
 
N
-
 
G
-
 
V
-
 
W
-
 
H
-
 
Q
-
 
N
-
 
V
-
 
F
-
 
A
-
 
Y
-
 
Y
I
 
L
S
 
S
V
 
I
A
 
S
C
 
C
M
 
N
H
 
H
C
 
C
S
 
E
D
 
D
A
 
P
P
 
A
C
 
C
M
 
T
A
 
K
V
 
V
C
 
C
P
 
P
V
 
S
N
 
G
C
 
A
F
 
M
Y
 
H
R
 
K
T
 
R
E
 
E
E
 
D
G
 
G
V
 
F
V
 
V
L
 
V
H
 
V
D
 
D
K
 
E
D
 
D
V
 
V
C
 
C
I
 
I
G
 
G
C
|
C
G
 
R
Y
 
Y
C
 
C
S
 
H
Y
 
M
A
 
A
C
 
C
P
 
P
F
 
Y
G
 
G
A
 
A
P
 
P
Q
 
Q
F
 
Y
P
 
N
S
 
E
Q
 
-
G
 
-
T
 
-
F
 
-
G
 
-
V
 
T
R
 
K
G
 
G
K
 
H
M
 
M
D
 
T
K
 
K
C
 
C
T
 
D
F
 
G
C
 
C
A
 
-
G
 
-
G
 
-
P
 
-
E
 
-
T
 
-
H
 
-
G
 
-
S
 
-
Q
 
-
A
 
-
E
 
-
F
 
-
E
 
-
K
 
-
Y
 
-
G
 
-
R
 
Y
N
 
D
R
 
R
L
 
V
A
 
A
E
 
E
G
 
G
K
 
K
L
 
K
P
 
P
A
 
I
C
 
C
A
 
V
E
 
E
M
 
S
C
 
C
S
 
P
T
 
L
K
 
R
A
 
A
L
 
L
L
 
D
A
 
F
G
 
G
D
 
P
G
 
I
D
 
D

Sites not aligning to the query:

2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
36% identity, 80% coverage: 1:164/205 of query aligns to 1:144/193 of 2vpyF

query
sites
2vpyF
M
 
M
A
 
P
R
 
R
M
 
Y
K
 
A
F
 
M
I
 
A
C
 
I
D
 
D
A
 
L
E
 
S
R
 
L
C
|
C
I
 
V
E
x
G
C
|
C
N
 
A
G
 
A
C
|
C
V
 
A
T
 
V
A
 
A
C
|
C
K
 
K
N
 
M
E
 
E
H
x
N
E
 
E
V
 
V
P
 
P
W
 
P
G
 
G
V
 
V
-
 
F
-
 
N
-
x
L
-
 
W
N
x
I
R
 
R
R
 
E
R
 
R
V
 
E
V
 
V
T
 
G
L
 
E
N
 
Y
D
 
P
G
 
N
V
 
L
P
 
V
G
 
V
E
 
E
K
 
F
S
 
R
I
x
P
S
 
E
V
 
-
A
x
Q
C
|
C
M
x
L
H
 
H
C
|
C
S
 
E
D
 
N
A
 
P
P
|
P
C
|
C
M
 
V
A
 
P
V
 
V
C
|
C
P
|
P
V
 
T
N
 
G
C
 
A
F
 
S
Y
 
Y
R
 
Q
T
 
T
E
 
K
E
 
D
G
 
G
V
 
L
V
|
V
L
 
L
H
 
V
D
 
D
K
 
P
D
 
K
V
 
K
C
|
C
I
|
I
G
x
A
C
|
C
G
|
G
Y
 
A
C
|
C
S
 
I
Y
 
A
A
 
A
C
|
C
P
|
P
F
x
Y
G
 
D
A
 
A
P
 
-
Q
 
-
F
 
-
P
 
-
S
 
-
Q
 
-
G
x
R
T
 
Y
F
 
L
G
 
H
V
 
P
R
 
A
G
 
G
K
 
Y
M
x
V
D
 
S
K
 
K
C
|
C
T
 
T
F
|
F
C
|
C
A
 
A
G
 
-
G
 
-
P
 
-
E
 
-
T
 
-
H
 
-
G
 
-
S
 
-
Q
 
-
A
 
-
E
 
-
F
 
-
E
 
-
K
 
-
Y
 
-
G
 
-
R
 
-
N
 
H
R
 
R
L
 
L
A
 
E
E
 
K
G
 
G
K
 
K
L
 
V
P
|
P
A
|
A
C
|
C
A
 
V
E
 
E
M
 
T
C
|
C
S
 
P
T
 
T
K
 
Y
A
x
C
L
x
R
L
 
T
A
 
F
G
 
G
D
 
D

Sites not aligning to the query:

2vpwF Polysulfide reductase with bound menaquinone (see paper)
36% identity, 80% coverage: 1:164/205 of query aligns to 1:144/193 of 2vpwF

query
sites
2vpwF
M
 
M
A
 
P
R
 
R
M
 
Y
K
 
A
F
 
M
I
 
A
C
 
I
D
 
D
A
 
L
E
 
S
R
 
L
C
|
C
I
 
V
E
x
G
C
|
C
N
 
A
G
 
A
C
|
C
V
 
A
T
 
V
A
 
A
C
|
C
K
 
K
N
 
M
E
 
E
H
x
N
E
 
E
V
 
V
P
 
P
W
 
P
G
 
G
V
 
V
-
 
F
-
 
N
-
x
L
-
 
W
N
x
I
R
 
R
R
 
E
R
 
R
V
 
E
V
 
V
T
 
G
L
 
E
N
 
Y
D
 
P
G
 
N
V
 
L
P
 
V
G
 
V
E
 
E
K
 
F
S
 
R
I
x
P
S
 
E
V
 
-
A
x
Q
C
|
C
M
x
L
H
|
H
C
|
C
S
 
E
D
 
N
A
 
P
P
|
P
C
|
C
M
 
V
A
 
P
V
 
V
C
|
C
P
|
P
V
 
T
N
 
G
C
 
A
F
 
S
Y
 
Y
R
 
Q
T
 
T
E
 
K
E
 
D
G
 
G
V
 
L
V
|
V
L
 
L
H
 
V
D
 
D
K
 
P
D
 
K
V
 
K
C
|
C
I
|
I
G
x
A
C
|
C
G
|
G
Y
 
A
C
|
C
S
 
I
Y
 
A
A
 
A
C
|
C
P
|
P
F
x
Y
G
 
D
A
 
A
P
 
-
Q
 
-
F
 
-
P
 
-
S
 
-
Q
 
-
G
x
R
T
 
Y
F
 
L
G
 
H
V
 
P
R
 
A
G
 
G
K
 
Y
M
x
V
D
 
S
K
 
K
C
|
C
T
 
T
F
|
F
C
|
C
A
 
A
G
 
-
G
 
-
P
 
-
E
 
-
T
 
-
H
 
-
G
 
-
S
 
-
Q
 
-
A
 
-
E
 
-
F
 
-
E
 
-
K
 
-
Y
 
-
G
 
-
R
 
-
N
 
H
R
 
R
L
 
L
A
 
E
E
 
K
G
 
G
K
 
K
L
 
V
P
|
P
A
|
A
C
|
C
A
 
V
E
 
E
M
 
T
C
|
C
S
 
P
T
 
T
K
 
Y
A
x
C
L
x
R
L
 
T
A
 
F
G
 
G
D
 
D

Sites not aligning to the query:

6f0kB Alternative complex iii (see paper)
30% identity, 77% coverage: 7:164/205 of query aligns to 727:915/961 of 6f0kB

query
sites
6f0kB
I
 
V
C
 
I
D
 
D
A
 
L
E
 
N
R
 
A
C
|
C
I
x
T
E
x
G
C
|
C
N
|
N
G
x
A
C
|
C
V
 
I
T
 
V
A
 
A
C
|
C
K
 
D
N
 
S
E
 
E
H
 
N
E
 
N
V
 
I
P
 
P
W
 
M
-
 
V
-
 
G
-
 
K
-
 
N
-
 
E
-
 
V
G
 
G
V
 
R
N
 
G
R
 
R
R
 
E
-
 
M
-
 
H
-
x
W
-
 
L
-
 
R
-
x
I
-
 
D
R
 
R
V
 
Y
V
 
F
T
 
V
L
 
S
N
 
D
D
 
E
G
 
A
V
 
H
P
 
A
G
 
D
E
 
D
K
 
P
S
 
Q
I
 
I
-
 
V
-
 
V
-
 
Q
S
 
P
V
 
V
A
 
P
C
|
C
M
|
M
H
|
H
C
|
C
S
 
E
D
 
N
A
 
A
P
|
P
C
|
C
M
 
E
A
 
S
V
 
V
C
|
C
P
 
P
V
|
V
N
 
A
C
 
A
F
 
T
Y
 
V
R
 
H
T
 
S
E
 
P
E
 
D
G
 
G
V
 
L
V
x
N
L
 
E
H
x
M
D
 
V
K
 
Y
D
x
N
V
x
R
C
|
C
I
|
I
G
|
G
C
 
T
G
 
R
Y
 
Y
C
|
C
S
 
S
Y
 
N
A
 
N
C
|
C
P
 
P
F
 
Y
G
 
K
A
 
V
P
 
R
Q
 
R
F
 
F
-
 
N
-
 
W
-
 
F
-
 
N
-
 
W
-
 
V
-
 
K
-
 
T
-
 
L
P
 
P
S
 
I
Q
 
Q
-
 
V
-
 
Q
-
 
M
-
 
A
-
 
Q
-
 
N
-
 
P
-
 
D
G
 
V
T
 
T
F
 
V
G
 
R
V
 
F
R
 
R
G
 
G
K
 
V
M
|
M
D
 
E
K
 
K
C
|
C
T
 
T
F
x
Y
C
|
C
A
 
V
G
 
Q
G
 
R
P
 
I
E
 
R
T
 
E
H
 
A
G
 
Q
S
x
R
Q
 
Q
A
 
A
E
x
N
F
 
I
E
 
E
K
 
K
Y
 
-
G
 
-
R
 
-
N
 
R
R
 
P
L
 
L
A
 
R
E
 
D
G
 
G
K
 
E
L
 
V
P
 
K
-
 
T
A
|
A
C
|
C
A
 
Q
E
 
Q
M
 
A
C
|
C
S
 
P
T
 
A
K
 
E
A
 
A
L
 
I
L
 
T
A
 
F
G
 
G
D
 
D

Sites not aligning to the query:

6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
29% identity, 80% coverage: 3:166/205 of query aligns to 2:194/234 of 6cz7B

query
sites
6cz7B
R
 
R
M
 
L
K
 
G
F
 
M
I
 
V
C
 
I
D
 
D
A
 
L
E
 
Q
R
 
K
C
|
C
I
x
V
E
x
G
C
|
C
N
x
G
G
 
G
C
|
C
V
 
S
T
 
L
A
 
A
C
|
C
K
 
K
N
 
T
E
 
E
H
x
N
E
 
N
V
 
T
P
 
N
W
 
D
G
 
G
V
 
I
N
 
H
R
 
W
R
 
S
R
 
H
V
 
H
V
 
I
T
 
A
L
 
T
N
 
T
D
 
E
G
 
G
V
 
T
-
 
F
P
 
P
G
 
D
E
 
V
K
 
K
S
 
Y
-
 
T
-
x
Y
I
 
I
S
x
P
V
 
T
A
 
L
C
|
C
M
x
N
H
|
H
C
|
C
S
 
D
D
 
D
A
|
A
P
|
P
C
|
C
M
 
V
A
 
K
V
 
V
C
|
C
P
|
P
V
 
T
N
 
G
C
 
A
F
 
M
Y
 
H
R
 
K
T
 
D
E
 
K
E
 
R
G
 
G
V
 
L
V
x
T
L
 
L
H
 
Q
D
 
N
K
 
N
D
 
D
V
 
E
C
|
C
I
|
I
G
|
G
C
|
C
G
x
K
Y
 
K
C
|
C
S
 
M
Y
 
N
A
 
A
C
|
C
P
 
P
F
x
Y
G
 
G
A
x
V
P
x
I
Q
 
S
F
 
F
P
 
-
S
 
N
Q
 
A
G
 
A
T
 
T
F
 
P
G
 
H
V
 
R
R
 
R
G
 
W
K
 
Q
M
 
D
D
 
D
-
 
S
-
 
E
-
 
V
-
 
V
-
 
A
-
 
N
-
 
G
-
 
T
-
 
V
-
 
S
-
 
P
-
 
L
-
 
M
-
 
L
-
 
L
K
 
K
C
 
R
T
 
T
F
 
G
C
 
A
A
 
T
G
 
A
G
 
T
P
 
P
E
 
N
T
 
E
H
 
N
G
 
P
S
 
E
Q
 
R
A
 
G
E
 
D
F
 
T
E
 
Y
K
 
P
Y
 
M
G
 
I
R
 
R
-
 
P
-
 
K
-
 
R
-
 
T
-
x
T
-
 
E
-
x
K
-
x
C
-
 
T
-
x
F
-
x
C
-
 
D
N
 
H
R
 
R
L
 
L
A
 
D
E
 
K
G
 
G
K
 
L
L
 
N
P
 
P
A
 
A
C
|
C
A
 
V
E
 
D
M
 
A
C
|
C
S
x
P
T
 
S
K
 
E
A
 
A
L
x
R
L
 
V
A
 
I
G
 
G
D
 
D
G
 
L
D
 
D

Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
29% identity, 80% coverage: 3:166/205 of query aligns to 2:194/234 of Q7WTT9

query
sites
Q7WTT9
R
 
R
M
 
L
K
 
G
F
 
M
I
 
V
C
 
I
D
 
D
A
 
L
E
 
Q
R
 
K
C
|
C
I
 
V
E
 
G
C
|
C
N
 
G
G
 
G
C
|
C
V
 
S
T
 
L
A
 
A
C
|
C
K
 
K
N
 
T
E
 
E
H
 
N
E
 
N
V
 
T
P
 
N
W
 
D
G
 
G
V
 
I
N
 
H
R
 
W
R
 
S
R
 
H
V
 
H
V
 
I
T
 
A
L
 
T
N
 
T
D
 
E
G
 
G
V
 
T
-
 
F
P
 
P
G
 
D
E
 
V
K
 
K
S
 
Y
-
 
T
-
 
Y
I
 
I
S
 
P
V
 
T
A
 
L
C
|
C
M
 
N
H
 
H
C
|
C
S
 
D
D
 
D
A
 
A
P
 
P
C
|
C
M
 
V
A
 
K
V
 
V
C
|
C
P
 
P
V
 
T
N
 
G
C
 
A
F
 
M
Y
 
H
R
 
K
T
 
D
E
 
K
E
 
R
G
 
G
V
 
L
V
 
T
L
 
L
H
 
Q
D
 
N
K
 
N
D
 
D
V
 
E
C
|
C
I
 
I
G
 
G
C
|
C
G
 
K
Y
 
K
C
|
C
S
 
M
Y
 
N
A
 
A
C
|
C
P
 
P
F
 
Y
G
 
G
A
 
V
P
 
I
Q
 
S
F
 
F
P
 
-
S
 
N
Q
 
A
G
 
A
T
 
T
F
 
P
G
 
H
V
 
R
R
 
R
G
 
W
K
 
Q
M
 
D
D
 
D
-
 
S
-
 
E
-
 
V
-
 
V
-
 
A
-
 
N
-
 
G
-
 
T
-
 
V
-
 
S
-
 
P
-
 
L
-
 
M
-
 
L
-
 
L
K
 
K
C
 
R
T
 
T
F
 
G
C
 
A
A
 
T
G
 
A
G
 
T
P
 
P
E
 
N
T
 
E
H
 
N
G
 
P
S
 
E
Q
 
R
A
 
G
E
 
D
F
 
T
E
 
Y
K
 
P
Y
 
M
G
 
I
R
 
R
-
 
P
-
 
K
-
 
R
-
 
T
-
 
T
-
 
E
-
 
K
-
x
C
-
 
T
-
 
F
-
x
C
-
 
D
N
 
H
R
 
R
L
 
L
A
 
D
E
 
K
G
 
G
K
 
L
L
 
N
P
 
P
A
 
A
C
|
C
A
 
V
E
 
D
M
 
A
C
|
C
S
 
P
T
 
S
K
 
E
A
 
A
L
 
R
L
 
V
A
 
I
G
 
G
D
 
D
G
 
L
D
 
D

7qv7A Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
30% identity, 91% coverage: 7:193/205 of query aligns to 6:174/174 of 7qv7A

query
sites
7qv7A
I
 
I
C
 
A
D
 
D
A
 
P
E
 
K
R
 
R
C
|
C
I
x
L
E
x
G
C
|
C
N
x
Y
G
 
T
C
|
C
V
 
I
T
 
A
A
 
A
C
|
C
K
 
A
N
 
F
E
 
V
H
|
H
E
 
E
V
 
-
P
 
E
W
 
Q
G
 
G
V
 
L
N
 
Q
-
 
P
-
 
F
-
 
P
R
 
R
R
x
L
R
 
Y
V
 
L
V
 
T
T
 
Y
L
 
T
N
 
S
D
 
E
G
 
G
V
 
I
P
 
-
G
 
-
E
 
-
K
 
-
S
 
-
I
 
M
S
 
P
V
 
I
A
 
Q
C
|
C
M
x
R
H
 
H
C
|
C
S
 
E
D
 
D
A
 
A
P
 
P
C
|
C
M
 
A
A
 
E
V
 
V
C
|
C
P
 
P
V
 
V
N
 
E
C
 
A
F
 
I
Y
 
-
R
 
K
T
 
K
E
 
E
E
 
G
G
 
N
V
 
A
V
 
I
L
 
I
H
 
I
D
 
D
K
 
E
D
 
K
V
 
A
C
|
C
I
|
I
G
|
G
C
|
C
G
 
K
Y
 
T
C
|
C
S
 
L
Y
 
L
A
 
A
C
|
C
P
 
S
F
 
F
G
 
G
A
 
A
P
x
I
Q
 
D
F
|
F
P
 
S
S
 
V
Q
 
Q
G
 
D
T
 
S
F
 
L
G
 
E
-
 
Q
-
 
S
-
 
I
-
 
F
-
 
K
-
 
D
-
 
I
-
 
K
-
 
E
-
 
N
-
 
L
V
 
M
R
 
R
G
 
I
K
 
V
M
 
A
D
 
V
K
 
K
C
|
C
T
 
D
F
x
L
C
|
C
A
 
-
G
 
-
G
 
-
P
 
-
E
 
-
T
 
-
H
 
-
G
 
-
S
 
-
Q
 
-
A
 
-
E
 
-
F
 
-
E
 
-
K
 
-
Y
 
-
G
 
-
R
 
-
N
 
N
R
 
F
L
 
R
A
 
E
E
 
E
G
 
G
K
 
-
L
 
-
P
 
P
A
|
A
C
|
C
A
 
V
E
 
Q
M
 
F
C
|
C
S
 
P
T
 
T
K
 
K
A
 
A
L
 
L
L
 
K
A
 
L
G
 
V
D
 
D
G
 
G
D
 
D
V
 
E
V
 
I
A
 
-
D
 
-
I
 
-
F
 
-
R
 
-
N
 
N
R
 
K
V
 
M
V
 
V
Q
 
K
R
 
N
G
 
K
K
 
R
G
 
T
A
 
V
E
 
N
V
 
V
W
 
E
G
 
S
W
 
L
G
 
L
T
 
S
A
 
V
Y
 
Y
G
 
G

8k9fB Cryo-em structure of the photosynthetic alternative complex iii from chloroflexus aurantiacus at 2.9 angstrom (see paper)
29% identity, 74% coverage: 13:164/205 of query aligns to 719:906/951 of 8k9fB

query
sites
8k9fB
C
|
C
I
 
I
E
x
G
C
|
C
N
|
N
G
 
A
C
|
C
V
 
V
T
 
V
A
 
A
C
|
C
K
 
Q
N
 
A
E
 
E
H
x
N
-
 
N
-
 
I
-
 
A
-
 
V
-
 
V
-
 
G
-
 
K
-
 
D
-
 
Q
-
 
V
-
 
S
-
 
R
-
 
G
-
 
R
E
 
E
V
 
M
P
 
H
W
|
W
G
x
I
V
 
R
N
 
I
R
 
D
R
 
R
R
 
Y
V
 
F
V
 
A
T
 
G
L
 
E
N
 
D
D
 
L
G
 
D
V
 
N
P
 
P
G
 
S
E
 
I
K
 
Y
S
 
M
I
 
M
S
x
P
V
 
V
A
 
N
C
|
C
M
|
M
H
x
Q
C
|
C
S
 
E
D
 
K
A
 
A
P
 
P
C
|
C
M
 
E
A
 
V
V
 
V
C
|
C
P
|
P
V
 
V
N
 
A
C
 
A
F
 
T
Y
 
V
R
 
H
T
 
D
E
 
Y
E
 
E
G
 
G
V
 
L
V
x
N
L
 
N
H
x
M
D
 
V
K
 
Y
D
x
N
V
x
R
C
|
C
I
 
V
G
|
G
C
x
T
G
x
K
Y
|
Y
C
|
C
S
 
S
Y
 
N
A
 
N
C
|
C
P
 
P
F
x
Y
G
 
K
A
x
V
P
 
R
Q
 
R
F
 
F
-
 
N
-
 
F
-
 
L
-
 
Q
-
 
Y
-
 
S
-
 
D
P
 
T
S
 
T
Q
 
T
G
 
E
T
 
T
F
 
F
G
 
K
-
 
L
-
 
A
-
 
F
-
 
N
-
 
P
-
 
D
-
 
V
-
 
T
-
 
V
-
 
R
V
 
I
R
 
R
G
 
G
K
 
V
M
 
M
D
 
E
K
 
K
C
|
C
T
 
T
F
x
Y
C
|
C
A
 
V
-
 
Q
-
 
R
-
 
I
G
 
S
G
 
G
P
 
A
E
x
R
T
 
I
H
 
A
G
 
A
S
x
K
Q
 
R
A
 
A
E
 
A
F
 
V
E
 
Q
K
 
A
Y
 
-
G
 
G
R
 
Q
N
 
S
R
 
S
-
 
Y
-
 
V
L
 
I
A
 
S
E
 
D
G
 
G
K
 
A
L
 
I
-
 
Q
P
x
T
A
 
A
C
|
C
A
 
E
E
 
Q
M
 
A
C
|
C
S
x
P
T
|
T
K
 
G
A
 
A
L
 
I
L
 
V
A
 
F
G
 
G
D
 
D

Sites not aligning to the query:

8k9eB Cryo-em structure of the photosynthetic alternative complex iii from chloroflexus aurantiacus at 3.3 angstrom (see paper)
29% identity, 74% coverage: 13:164/205 of query aligns to 719:906/951 of 8k9eB

query
sites
8k9eB
C
|
C
I
|
I
E
x
G
C
|
C
N
|
N
G
 
A
C
|
C
V
 
V
T
 
V
A
 
A
C
|
C
K
 
Q
N
 
A
E
 
E
H
x
N
-
 
N
-
 
I
-
 
A
-
 
V
-
 
V
-
 
G
-
 
K
-
 
D
-
 
Q
-
 
V
-
 
S
-
 
R
-
 
G
-
 
R
E
 
E
V
 
M
P
 
H
W
 
W
G
 
I
V
 
R
N
x
I
R
 
D
R
 
R
R
 
Y
V
 
F
V
 
A
T
 
G
L
 
E
N
 
D
D
 
L
G
 
D
V
 
N
P
 
P
G
 
S
E
 
I
K
 
Y
S
 
M
I
 
M
S
 
P
V
 
V
A
 
N
C
|
C
M
|
M
H
 
Q
C
|
C
S
 
E
D
 
K
A
 
A
P
|
P
C
|
C
M
 
E
A
 
V
V
 
V
C
|
C
P
 
P
V
 
V
N
 
A
C
 
A
F
 
T
Y
 
V
R
 
H
T
 
D
E
 
Y
E
 
E
G
 
G
V
 
L
V
x
N
L
 
N
H
x
M
D
 
V
K
 
Y
D
x
N
V
 
R
C
|
C
I
x
V
G
|
G
C
x
T
G
x
K
Y
|
Y
C
|
C
S
 
S
Y
 
N
A
 
N
C
|
C
P
 
P
F
x
Y
G
 
K
A
x
V
P
x
R
Q
 
R
F
 
F
-
 
N
-
 
F
-
 
L
-
 
Q
-
 
Y
-
 
S
-
 
D
P
 
T
S
 
T
Q
 
T
G
 
E
T
 
T
F
 
F
G
 
K
-
 
L
-
 
A
-
 
F
-
 
N
-
 
P
-
 
D
-
 
V
-
 
T
-
 
V
-
 
R
V
 
I
R
 
R
G
 
G
K
 
V
M
|
M
D
 
E
K
 
K
C
|
C
T
 
T
F
x
Y
C
|
C
A
 
V
-
 
Q
-
 
R
-
 
I
G
 
S
G
 
G
P
 
A
E
x
R
T
 
I
H
 
A
G
 
A
S
x
K
Q
 
R
A
 
A
E
 
A
F
 
V
E
 
Q
K
 
A
Y
 
-
G
 
G
R
 
Q
N
 
S
R
 
S
-
 
Y
-
 
V
L
 
I
A
 
S
E
 
D
G
 
G
K
 
A
L
 
I
-
 
Q
P
x
T
A
 
A
C
|
C
A
 
E
E
 
Q
M
 
A
C
|
C
S
 
P
T
|
T
K
 
G
A
 
A
L
 
I
L
 
V
A
 
F
G
 
G
D
 
D

Sites not aligning to the query:

6lodB Cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii (see paper)
27% identity, 77% coverage: 8:164/205 of query aligns to 687:884/929 of 6lodB

query
sites
6lodB
C
 
I
D
 
D
A
 
L
E
 
N
R
 
V
C
|
C
I
x
N
E
x
S
C
|
C
N
|
N
G
x
A
C
|
C
V
 
V
T
 
V
A
 
A
C
|
C
K
 
Q
N
 
S
E
 
E
H
x
N
E
 
N
V
 
I
P
 
P
-
 
V
-
 
V
-
 
G
-
 
K
-
 
D
-
 
E
-
 
V
W
 
W
G
 
L
V
 
G
N
 
R
R
 
E
R
 
M
R
 
H
V
x
W
V
 
I
T
 
R
L
x
I
N
 
D
-
 
Q
-
 
Y
-
 
Y
-
 
V
-
 
G
-
 
D
D
 
E
G
 
H
V
 
T
P
 
P
G
 
N
E
 
V
K
 
Y
S
 
N
I
 
M
S
 
V
V
 
M
A
x
L
C
|
C
M
x
Q
H
x
Q
C
|
C
S
 
E
D
 
H
A
 
A
P
|
P
C
|
C
M
 
E
A
 
I
V
|
V
C
|
C
P
|
P
V
 
V
N
 
A
C
 
A
F
 
T
Y
 
V
R
 
H
T
 
D
E
 
A
E
 
E
G
 
G
V
 
L
V
x
N
L
 
N
H
 
M
D
 
V
K
 
Y
D
x
N
V
x
R
C
|
C
I
x
V
G
|
G
C
x
T
G
 
K
Y
 
Y
C
|
C
S
 
S
Y
 
N
A
 
N
C
|
C
P
 
P
F
x
Y
G
 
K
A
x
V
P
x
R
Q
 
R
F
 
F
-
 
N
-
 
F
-
 
L
-
 
Q
-
 
Y
-
 
Q
-
 
D
-
 
V
P
 
P
S
 
Y
Q
 
R
G
 
S
-
 
P
-
 
I
-
 
D
-
 
A
-
 
S
-
 
T
-
 
E
-
 
N
-
 
D
-
 
S
-
 
I
-
 
P
-
 
V
-
 
L
-
 
K
-
 
M
-
 
M
-
 
R
-
 
N
-
 
P
-
 
D
-
 
V
T
 
T
F
 
V
G
 
R
V
 
A
R
 
R
G
 
G
K
 
V
M
|
M
D
 
E
K
|
K
C
|
C
T
 
T
F
|
F
C
|
C
A
 
V
G
 
Q
G
 
R
P
 
I
E
 
N
T
 
E
H
 
A
G
x
R
S
x
I
Q
 
Q
A
 
A
E
x
R
F
 
T
E
 
E
K
 
N
Y
 
-
G
 
-
R
 
-
N
 
R
R
 
R
L
 
I
A
 
A
E
 
D
G
 
G
K
 
E
-
 
I
L
 
M
P
x
T
A
 
A
C
|
C
A
 
Q
E
 
Q
M
 
V
C
|
C
S
 
P
T
 
T
K
 
Q
A
 
A
L
x
I
L
 
V
A
 
F
G
 
G
D
 
D

7z0sB Structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) (see paper)
30% identity, 78% coverage: 6:165/205 of query aligns to 5:169/170 of 7z0sB

query
sites
7z0sB
F
 
V
I
 
I
C
 
A
D
 
D
A
 
S
E
 
T
R
 
L
C
|
C
I
|
I
E
x
G
C
|
C
N
x
H
G
x
T
C
|
C
V
 
E
T
 
A
A
 
A
C
|
C
K
 
S
N
 
E
E
 
T
H
|
H
E
 
R
V
 
Q
P
 
H
W
 
G
G
 
L
V
 
Q
N
 
S
R
 
M
R
 
P
R
|
R
V
x
L
-
 
R
V
 
V
T
 
M
L
 
L
N
 
N
D
 
E
G
 
-
V
 
-
P
 
-
G
 
-
E
 
K
K
 
E
S
 
S
I
 
A
S
x
P
V
 
Q
A
x
L
C
|
C
M
x
H
H
|
H
C
|
C
S
 
E
D
 
D
A
 
A
P
 
P
C
|
C
M
 
A
A
 
V
V
 
V
C
|
C
P
|
P
V
 
V
N
 
N
C
 
A
F
x
I
Y
 
T
R
 
R
T
 
V
E
 
D
E
 
-
G
 
G
V
 
A
V
|
V
L
 
Q
H
x
L
D
 
N
K
 
E
D
 
S
V
 
L
C
|
C
I
x
V
G
 
S
C
|
C
G
x
K
Y
 
L
C
|
C
S
 
G
Y
 
I
A
 
A
C
|
C
P
 
P
F
 
F
G
 
G
A
 
A
P
x
I
Q
 
E
F
 
F
-
 
S
-
 
G
-
 
S
-
 
R
-
 
P
-
 
L
-
 
D
-
 
I
P
 
P
S
 
A
Q
 
N
G
 
A
T
 
N
F
 
T
-
 
P
-
 
K
-
 
A
-
 
P
-
 
P
-
 
A
-
 
P
-
 
P
-
 
A
-
 
P
-
 
A
-
 
R
-
 
V
-
 
S
-
 
T
-
 
L
-
 
L
-
 
D
-
 
W
-
 
V
-
 
P
G
 
G
V
 
I
R
 
R
G
 
A
K
 
I
M
x
A
D
 
V
K
|
K
C
|
C
T
x
D
F
x
L
C
|
C
A
 
S
G
 
-
G
 
-
P
 
-
E
 
-
T
 
-
H
 
-
G
 
-
S
 
-
Q
 
-
A
 
-
E
 
-
F
 
F
E
 
D
K
 
E
Y
 
Q
G
 
G
R
 
-
N
 
-
R
 
-
L
 
-
A
 
-
E
 
-
G
 
-
K
 
-
L
 
-
P
|
P
A
 
A
C
|
C
A
 
V
E
 
R
M
 
M
C
|
C
S
x
P
T
|
T
K
 
K
A
 
A
L
|
L
L
 
H
A
 
L
G
 
V
D
 
D
G
 
N

P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
25% identity, 97% coverage: 2:200/205 of query aligns to 28:234/294 of P0AAJ3

query
sites
P0AAJ3
A
 
A
R
 
E
M
 
V
K
 
A
F
 
K
I
 
L
C
 
I
D
 
D
A
 
V
E
 
S
R
 
T
C
|
C
I
 
I
E
 
G
C
|
C
N
 
K
G
 
A
C
|
C
V
 
Q
T
 
V
A
 
A
C
|
C
K
 
S
N
 
E
E
 
W
H
 
N
E
 
D
V
 
I
P
 
R
W
 
D
G
 
E
V
 
V
N
 
G
R
 
H
R
 
C
R
 
V
V
 
G
V
 
V
T
 
Y
L
 
D
N
 
N
D
 
P
G
 
A
V
 
D
P
 
L
G
 
S
E
 
A
K
 
K
S
 
S
I
 
W
S
 
T
V
 
V
A
 
M
-
 
R
-
 
F
-
 
S
-
 
E
-
 
T
-
 
E
-
 
Q
-
 
N
-
 
G
-
 
K
-
 
L
-
 
E
-
 
W
-
 
L
-
 
I
-
 
R
-
 
K
-
 
D
-
 
G
C
|
C
M
 
M
H
 
H
C
|
C
S
 
E
D
 
D
A
 
P
P
 
G
C
|
C
M
 
L
A
 
K
V
 
A
C
|
C
P
 
P
-
 
S
V
 
A
N
 
G
C
 
A
F
 
I
Y
 
I
R
 
Q
T
 
Y
E
 
A
E
 
N
G
 
G
V
 
I
V
 
V
L
 
D
H
 
F
D
 
Q
K
 
S
D
 
E
V
 
N
C
|
C
I
 
I
G
 
G
C
|
C
G
 
G
Y
 
Y
C
|
C
S
 
I
Y
 
A
A
 
G
C
|
C
P
 
P
F
 
F
G
 
N
A
 
I
P
 
P
Q
 
R
F
 
L
P
 
N
S
 
K
Q
 
E
G
 
D
T
 
N
F
 
-
G
 
-
V
 
-
R
 
-
G
 
-
K
 
R
M
 
V
D
 
Y
K
 
K
C
|
C
T
 
T
F
 
L
C
|
C
A
 
V
G
 
-
G
 
-
P
 
-
E
 
-
T
 
-
H
 
-
G
 
-
S
 
-
Q
 
-
A
 
-
E
 
-
F
 
-
E
 
-
K
 
-
Y
 
-
G
 
-
R
 
-
N
 
D
R
 
R
L
 
V
A
 
S
E
 
V
G
 
G
K
 
Q
L
 
E
P
 
P
A
 
A
C
|
C
A
 
V
E
 
K
M
 
T
C
|
C
S
 
P
T
 
T
K
 
G
A
 
A
L
 
I
L
 
H
A
 
F
G
 
G
D
 
T
G
 
K
D
 
K
V
 
E
V
 
M
A
 
L
D
 
E
I
 
L
F
 
A
R
 
E
N
 
Q
R
 
R
V
 
V
V
 
A
Q
 
K
-
 
L
R
 
K
G
 
A
K
 
R
G
 
G
A
 
Y
E
 
E
-
 
H
-
 
A
-
 
G
-
 
V
-
 
Y
-
 
N
-
 
P
-
 
E
-
 
G
V
 
V
W
 
G
G
 
G
W
 
T
G
 
H
T
 
V
A
 
M
Y
 
Y
G
 
V
S
 
L
Q
 
H
Q
 
H
A
 
A
G
 
D
Q
 
Q
P
 
P

1kqfB Formate dehydrogenase n from e. Coli (see paper)
25% identity, 97% coverage: 2:200/205 of query aligns to 27:233/289 of 1kqfB

query
sites
1kqfB
A
 
A
R
 
E
M
 
V
K
 
A
F
x
K
I
 
L
C
 
I
D
 
D
A
 
V
E
 
S
R
 
T
C
|
C
I
|
I
E
x
G
C
|
C
N
x
K
G
 
A
C
|
C
V
 
Q
T
 
V
A
 
A
C
|
C
K
 
S
N
 
E
E
 
W
H
x
N
E
 
D
V
 
I
P
 
R
W
 
D
G
 
E
V
 
V
N
 
G
R
 
H
R
 
C
R
 
V
V
 
G
V
 
V
T
 
Y
L
 
D
N
 
N
D
 
P
G
 
A
V
 
D
P
 
L
G
 
S
E
 
A
K
 
K
S
 
S
I
 
W
S
x
T
V
 
V
A
x
M
-
 
R
-
 
F
-
 
S
-
 
E
-
 
T
-
 
E
-
 
Q
-
 
N
-
 
G
-
 
K
-
 
L
-
 
E
-
 
W
-
 
L
-
 
I
-
 
R
-
 
K
-
 
D
-
 
G
C
|
C
M
|
M
H
|
H
C
|
C
S
 
E
D
 
D
A
x
P
P
 
G
C
|
C
M
 
L
A
 
K
V
 
A
C
|
C
P
|
P
-
 
S
V
 
A
N
 
G
C
 
A
F
x
I
Y
 
I
R
 
Q
T
 
Y
E
 
A
E
 
N
G
 
G
V
 
I
V
|
V
L
 
D
H
 
F
D
 
Q
K
 
S
D
 
E
V
 
N
C
|
C
I
|
I
G
|
G
C
|
C
G
|
G
Y
|
Y
C
|
C
S
 
I
Y
 
A
A
 
G
C
|
C
P
 
P
F
 
F
G
 
N
A
x
I
P
|
P
Q
 
R
F
 
L
P
 
N
S
 
K
Q
 
E
G
 
D
T
 
N
F
 
-
G
 
-
V
 
-
R
 
-
G
 
-
K
 
R
M
x
V
D
 
Y
K
|
K
C
|
C
T
 
T
F
x
L
C
|
C
A
 
V
G
 
-
G
 
-
P
 
-
E
 
-
T
 
-
H
 
-
G
 
-
S
 
-
Q
 
-
A
 
-
E
 
-
F
 
-
E
 
-
K
 
-
Y
 
-
G
 
-
R
 
-
N
 
D
R
 
R
L
 
V
A
 
S
E
 
V
G
 
G
K
 
Q
L
 
E
P
|
P
A
 
A
C
|
C
A
 
V
E
 
K
M
 
T
C
|
C
S
x
P
T
 
T
K
 
G
A
 
A
L
x
I
L
 
H
A
 
F
G
 
G
D
 
T
G
 
K
D
 
K
V
 
E
V
 
M
A
 
L
D
 
E
I
 
L
F
 
A
R
 
E
N
 
Q
R
 
R
V
 
V
V
 
A
Q
 
K
-
 
L
R
 
K
G
 
A
K
 
R
G
 
G
A
 
Y
E
 
E
-
 
H
-
 
A
-
 
G
-
 
V
-
 
Y
-
 
N
-
 
P
-
 
E
-
 
G
V
 
V
W
 
G
G
 
G
W
 
T
G
 
H
T
 
V
A
 
M
Y
 
Y
G
 
V
S
 
L
Q
 
H
Q
 
H
A
 
A
G
 
D
Q
 
Q
P
 
P

Sites not aligning to the query:

6x6uB Wor5 from pyrococcus furiosus, taurine-bound (see paper)
31% identity, 61% coverage: 3:127/205 of query aligns to 2:120/167 of 6x6uB

query
sites
6x6uB
R
 
R
M
 
I
K
 
W
F
 
I
I
 
L
C
 
I
D
 
T
A
 
P
E
x
D
R
 
K
C
|
C
I
x
S
E
 
G
C
|
C
N
x
R
G
 
L
C
|
C
V
 
E
T
 
V
A
 
T
C
|
C
K
 
S
N
 
L
E
 
E
H
|
H
E
 
E
-
 
G
V
 
I
P
 
I
W
 
W
G
 
P
-
 
E
V
 
A
N
 
S
R
|
R
R
x
I
R
 
R
V
|
V
V
 
F
T
 
E
L
 
L
N
 
F
D
 
P
G
 
G
V
 
I
P
 
-
G
 
-
E
 
-
K
 
-
S
 
N
I
 
V
S
 
P
V
 
H
A
 
T
C
|
C
M
x
V
H
 
Q
C
|
C
S
 
P
D
 
D
A
 
Y
P
|
P
C
|
C
M
 
V
A
 
N
V
 
A
C
|
C
P
|
P
V
 
T
N
 
N
C
 
A
F
x
L
Y
 
S
R
 
V
T
 
D
E
 
E
E
 
K
-
 
T
G
 
G
V
 
A
V
 
V
L
 
V
H
 
V
D
 
N
K
 
E
D
 
E
V
 
K
C
|
C
I
|
I
G
x
T
C
|
C
G
|
G
Y
 
A
C
|
C
S
 
V
Y
 
L
A
 
A
C
|
C
P
 
P
F
 
G
G
 
K
A
 
V
P
|
P
Q
 
R
F
 
I
P
 
P
S
 
A
Q
 
G
G
 
-
T
 
-
F
 
-
G
 
-
V
 
-
R
 
K
G
 
G
K
 
S
M
 
V
D
 
V
K
 
I
C
|
C
T
x
D
F
x
L
C
|
C
A
 
G
G
 
G
G
 
N
P
|
P
E
 
K

Sites not aligning to the query:

8c0zC Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
29% identity, 77% coverage: 9:166/205 of query aligns to 8:137/158 of 8c0zC

query
sites
8c0zC
D
 
D
A
 
P
E
 
A
R
 
K
C
|
C
I
x
T
E
 
G
C
|
C
N
 
L
G
 
Q
C
|
C
V
 
E
T
 
M
A
 
A
C
|
C
K
 
S
N
 
Y
E
 
E
H
 
H
E
 
T
V
 
G
P
 
V
W
 
I
G
 
N
V
 
P
N
 
S
R
 
K
R
 
S
R
 
R
V
 
I
V
 
K
T
 
V
L
 
F
N
 
S
D
 
F
G
 
E
V
 
H
P
 
E
G
 
G
E
 
R
K
 
K
S
 
-
I
 
V
S
 
P
V
 
Y
A
 
T
C
|
C
M
 
T
H
 
Q
C
|
C
S
 
T
D
 
E
A
 
A
P
 
W
C
|
C
M
 
L
A
 
H
V
 
S
C
|
C
P
 
P
V
 
V
N
 
D
C
 
A
F
x
I
-
 
R
Y
 
L
R
 
D
T
 
L
E
 
T
E
 
T
G
 
G
V
 
A
V
 
K
L
 
M
H
 
V
D
 
F
K
 
E
D
 
D
V
 
T
C
|
C
I
 
V
G
 
G
C
|
C
G
 
K
Y
 
V
C
|
C
S
 
T
Y
 
I
A
 
A
C
|
C
P
 
P
F
 
F
G
 
G
A
x
T
P
 
I
Q
 
N
F
 
Y
P
 
-
S
 
N
Q
 
Q
G
 
D
T
 
T
F
 
-
G
 
-
V
 
-
R
 
-
G
 
G
K
 
K
M
 
V
D
 
Q
K
|
K
C
|
C
T
 
D
F
 
L
C
|
C
A
 
E
G
 
G
G
 
D
P
 
-
E
 
-
T
 
-
H
 
-
G
 
-
S
 
-
Q
 
-
A
 
-
E
 
-
F
 
-
E
 
-
K
 
-
Y
 
-
G
 
-
R
 
-
N
 
-
R
 
-
L
 
-
A
 
-
E
 
-
G
 
-
K
 
-
L
 
-
P
 
P
A
 
A
C
|
C
A
 
A
E
 
K
M
 
A
C
|
C
S
 
P
T
|
T
K
 
A
A
 
A
L
 
I
L
 
T
A
 
Y
G
 
I
D
 
D
G
 
A
D
 
D

7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
31% identity, 50% coverage: 6:107/205 of query aligns to 7:114/183 of 7qv7B

query
sites
7qv7B
F
 
V
I
 
V
C
 
A
D
 
N
A
 
P
E
 
A
R
 
K
C
|
C
I
 
I
E
x
G
C
|
C
N
x
K
G
x
A
C
|
C
V
 
E
T
 
V
A
 
A
C
|
C
-
 
F
-
 
A
-
 
V
-
x
H
-
 
N
K
 
R
N
 
N
E
 
N
H
 
H
-
 
V
-
 
G
-
 
A
-
 
T
-
 
V
-
 
G
-
 
T
-
 
V
E
 
S
V
 
I
P
 
P
W
 
V
G
 
-
V
 
I
N
 
P
R
|
R
R
 
L
R
 
H
V
 
L
V
 
I
T
 
K
L
 
T
N
 
E
D
 
H
G
 
G
V
 
-
P
 
-
G
 
-
E
 
-
K
 
-
S
 
T
I
 
M
S
 
P
V
 
I
A
 
Q
C
|
C
M
x
R
H
|
H
C
|
C
S
 
E
D
 
D
A
|
A
P
 
P
C
|
C
M
 
A
A
 
N
V
 
V
C
|
C
P
 
T
V
 
V
N
 
G
C
x
A
F
x
I
Y
 
K
R
 
R
T
 
E
E
 
G
E
 
N
G
 
A
V
 
I
V
 
V
L
 
V
H
 
-
D
 
D
K
 
E
D
 
K
V
 
L
C
|
C
I
|
I
G
 
G
C
|
C
G
 
K
Y
 
S
C
|
C
S
 
L
Y
 
L
A
 
A
C
|
C
P
 
P
F
 
F
G
 
G
A
 
A
P
x
I
Q
 
E
F
 
L
P
 
L
S
 
P
Q
 
Q

Sites not aligning to the query:

6btmB Structure of alternative complex iii from flavobacterium johnsoniae (wild type) (see paper)
25% identity, 56% coverage: 9:122/205 of query aligns to 689:868/948 of 6btmB

query
sites
6btmB
D
 
D
A
 
L
E
 
N
R
 
A
C
 
C
I
 
T
E
 
G
C
 
C
N
 
G
G
 
A
C
 
C
V
 
V
T
 
I
A
 
A
C
 
C
K
 
H
N
 
A
E
 
E
H
 
N
E
 
N
V
 
V
P
 
P
-
 
V
-
 
V
-
 
G
-
 
K
-
 
A
-
 
E
-
 
V
-
 
R
-
 
R
-
 
S
-
 
R
-
 
D
-
 
M
-
 
H
W
 
W
-
 
L
-
 
R
-
 
I
-
 
D
-
 
R
-
 
Y
-
 
Y
-
 
S
-
 
S
-
 
E
-
 
S
-
 
T
-
 
F
-
 
E
G
 
G
V
 
D
N
 
N
R
 
E
R
 
R
R
 
K
-
 
E
-
 
G
-
 
I
-
 
A
-
 
G
-
 
L
-
 
S
-
 
S
-
 
S
V
 
L
V
 
S
T
 
T
L
 
F
N
 
N
D
 
E
-
 
M
G
 
E
V
 
K
P
 
P
G
 
G
E
 
D
K
 
N
S
 
P
I
 
Q
-
 
V
-
 
A
-
 
F
-
 
Q
S
 
P
V
 
V
A
 
M
C
|
C
M
x
Q
H
 
H
C
|
C
S
 
N
D
 
H
A
 
A
P
 
P
C
|
C
M
 
E
A
 
T
V
 
V
C
|
C
P
 
P
V
 
V
N
 
A
C
 
A
F
 
T
Y
 
S
R
 
H
T
 
G
E
 
R
E
 
Q
G
 
G
V
 
Q
V
x
N
L
 
H
H
 
M
D
 
A
K
 
Y
D
 
N
V
 
R
C
|
C
I
x
V
G
 
G
C
x
T
G
 
R
Y
 
Y
C
|
C
S
 
A
Y
 
N
A
 
N
C
|
C
P
 
P
F
 
Y
G
 
K
A
 
V
P
x
R
Q
 
R
F
 
F
-
 
N
-
 
W
-
 
F
-
 
L
-
 
Y
-
 
N
-
 
K
P
 
N
S
 
S
Q
 
E
G
 
F
T
 
D
F
 
Y
G
 
H
V
 
M
-
 
N
-
 
D
-
 
D
-
 
L
-
 
G
-
 
R
-
 
M
-
 
V
-
 
L
-
 
N
-
 
P
-
 
D
-
 
V
-
 
N
-
 
V
-
 
R
-
 
S
R
 
R
G
 
G
K
 
V
M
|
M
D
 
E
K
 
K
C
 
C
T
 
S
F
 
F
C
 
C

Sites not aligning to the query:

3egwB The crystal structure of the narghi mutant narh - c16a
39% identity, 33% coverage: 55:122/205 of query aligns to 184:247/509 of 3egwB

query
sites
3egwB
C
|
C
M
x
E
H
|
H
C
|
C
S
 
L
D
 
N
A
x
P
P
 
A
C
|
C
M
 
V
A
 
A
V
 
T
C
|
C
P
 
P
V
x
S
N
 
G
C
 
A
F
x
I
Y
 
Y
-
 
K
R
 
R
T
 
E
E
 
E
E
 
D
G
 
G
V
 
I
V
 
V
L
 
L
H
 
I
D
 
D
K
 
Q
D
 
D
V
 
K
C
|
C
I
x
R
G
|
G
C
x
W
G
x
R
Y
 
M
C
|
C
S
 
I
Y
 
T
A
 
G
C
|
C
P
 
P
F
 
Y
G
 
K
A
 
K
P
x
I
Q
 
Y
F
 
F
P
 
N
S
 
W
Q
 
K
G
 
S
T
 
-
F
 
-
G
 
-
V
 
-
R
 
-
G
 
G
K
 
K
M
x
S
D
 
E
K
|
K
C
|
C
T
 
I
F
|
F
C
|
C

Sites not aligning to the query:

P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 33% coverage: 55:122/205 of query aligns to 184:247/512 of P11349

query
sites
P11349
C
|
C
M
 
E
H
 
H
C
|
C
S
 
L
D
 
N
A
 
P
P
 
A
C
|
C
M
 
V
A
 
A
V
 
T
C
|
C
P
 
P
V
 
S
N
 
G
C
 
A
F
 
I
Y
 
Y
-
 
K
R
 
R
T
 
E
E
 
E
E
 
D
G
 
G
V
 
I
V
 
V
L
 
L
H
 
I
D
 
D
K
 
Q
D
 
D
V
 
K
C
|
C
I
 
R
G
 
G
C
 
W
G
 
R
Y
 
M
C
|
C
S
 
I
Y
 
T
A
 
G
C
|
C
P
 
P
F
 
Y
G
 
K
A
 
K
P
 
I
Q
 
Y
F
 
F
P
 
N
S
 
W
Q
 
K
G
 
S
T
 
-
F
 
-
G
 
-
V
 
-
R
 
-
G
 
G
K
 
K
M
 
S
D
 
E
K
 
K
C
|
C
T
 
I
F
 
F
C
|
C

Sites not aligning to the query:

4v4cB Pyrogallol hydroxytransferase small subunit (see paper)
27% identity, 60% coverage: 1:123/205 of query aligns to 1:130/274 of 4v4cB

query
sites
4v4cB
M
 
M
A
 
E
R
 
Q
M
 
Y
K
 
Y
F
 
M
I
 
V
C
 
I
D
 
D
A
 
V
E
 
A
R
 
K
C
|
C
I
x
Q
E
x
D
C
|
C
N
|
N
G
x
N
C
|
C
V
 
F
T
 
M
A
 
G
C
|
C
K
 
M
N
 
D
E
 
E
H
 
H
E
 
E
V
 
L
-
 
N
P
 
E
W
 
W
-
 
P
-
 
G
-
 
Y
-
 
T
-
 
A
-
 
S
-
 
M
-
 
Q
-
 
R
G
 
G
V
 
H
N
 
R
R
 
W
R
 
M
R
 
N
V
 
I
V
 
E
T
 
R
L
 
R
N
 
E
D
 
R
G
 
G
V
 
T
P
 
Y
G
 
P
E
 
R
K
 
N
S
 
D
I
|
I
S
x
N
-
 
Y
-
 
R
-
 
P
V
 
T
A
 
P
C
|
C
M
|
M
H
|
H
C
|
C
S
 
E
D
 
N
A
 
A
P
 
P
C
|
C
M
 
V
A
 
A
V
 
K
C
 
G
P
 
N
V
 
-
N
 
G
C
 
A
F
 
V
Y
 
Y
R
 
Q
T
 
R
E
 
E
E
 
D
G
 
G
V
 
I
V
|
V
L
 
L
H
 
I
D
 
D
K
 
P
D
 
E
V
 
K
C
 
A
I
 
K
G
 
G
C
 
K
G
 
K
Y
 
E
C
 
L
S
 
L
Y
 
D
A
 
T
C
|
C
P
 
P
F
 
Y
G
 
G
A
x
V
P
 
M
Q
 
Y
F
 
W
P
 
N
S
 
E
Q
 
E
G
 
E
T
 
N
F
 
V
G
 
A
V
 
-
R
 
-
G
 
-
K
 
-
M
 
-
D
 
Q
K
 
K
C
|
C
T
 
T
F
x
M
C
|
C
A
 
A

Sites not aligning to the query:

Query Sequence

>Ac3H11_3802 FitnessBrowser__acidovorax_3H11:Ac3H11_3802
MARMKFICDAERCIECNGCVTACKNEHEVPWGVNRRRVVTLNDGVPGEKSISVACMHCSD
APCMAVCPVNCFYRTEEGVVLHDKDVCIGCGYCSYACPFGAPQFPSQGTFGVRGKMDKCT
FCAGGPETHGSQAEFEKYGRNRLAEGKLPACAEMCSTKALLAGDGDVVADIFRNRVVQRG
KGAEVWGWGTAYGSQQAGQPAGGKS

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory