Comparing Ac3H11_4162 FitnessBrowser__acidovorax_3H11:Ac3H11_4162 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
42% identity, 94% coverage: 13:322/329 of query aligns to 14:289/308 of P27305
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
41% identity, 94% coverage: 13:322/329 of query aligns to 2:275/290 of 4a91A
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
37% identity, 80% coverage: 18:281/329 of query aligns to 6:247/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
37% identity, 80% coverage: 18:281/329 of query aligns to 6:247/471 of P04805
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
38% identity, 80% coverage: 18:281/329 of query aligns to 6:258/485 of Q8DLI5
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
38% identity, 80% coverage: 18:281/329 of query aligns to 5:257/484 of 2cfoA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
31% identity, 81% coverage: 18:282/329 of query aligns to 106:343/564 of 3al0C
Sites not aligning to the query:
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
34% identity, 80% coverage: 18:281/329 of query aligns to 6:232/380 of 4g6zA
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
30% identity, 80% coverage: 18:279/329 of query aligns to 6:266/502 of 6brlA
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
31% identity, 80% coverage: 18:281/329 of query aligns to 5:260/485 of 4griB
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
33% identity, 81% coverage: 16:282/329 of query aligns to 3:254/468 of 1g59A
Sites not aligning to the query:
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
33% identity, 81% coverage: 16:282/329 of query aligns to 3:254/468 of 2cv2A
Sites not aligning to the query:
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
33% identity, 81% coverage: 16:282/329 of query aligns to 3:254/468 of 2cv1A
Sites not aligning to the query:
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
33% identity, 81% coverage: 16:282/329 of query aligns to 3:254/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
33% identity, 81% coverage: 16:282/329 of query aligns to 3:254/468 of 1n78A
Sites not aligning to the query:
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
33% identity, 81% coverage: 16:282/329 of query aligns to 3:254/468 of 1j09A
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 81% coverage: 16:282/329 of query aligns to 3:254/468 of P27000
Sites not aligning to the query:
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
32% identity, 84% coverage: 18:295/329 of query aligns to 7:275/488 of 8vc5A
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
27% identity, 74% coverage: 18:260/329 of query aligns to 14:228/455 of 3aiiA
Sites not aligning to the query:
4h3sA The structure of glutaminyl-tRNA synthetase from saccharomyces cerevisiae (see paper)
26% identity, 38% coverage: 18:142/329 of query aligns to 41:157/585 of 4h3sA
Sites not aligning to the query:
>Ac3H11_4162 FitnessBrowser__acidovorax_3H11:Ac3H11_4162
MTERAAPEPSGAARYIGRFAPSPTGPLHAGSLVAALASWLDARAHGGQWLVRIEDVDTPR
CVPGADQFILQQLATCGLVPDAPPEWQSARSAHYQRALDQLVAQGHAYPCACSRKDVEDA
QAALGHARERHAALPYPGTCRHGLRGRTGRSWRFNATDFKQKQALPPDGYASSAINSIAN
NTLHWHDRRLGLQQQDVARSVGDFVLHRADGLWAYQLAVVVDDAAQGITDVVRGEDLADN
TPRQILLQQALGVPTPRYLHTPLVCGANGEKLSKQNGARALDLADPLQALSQAALVLGLP
ALEHPHNNHLGDAQTQWVAAWRRHYNGSP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory