SitesBLAST
Comparing Ac3H11_4818 FitnessBrowser__acidovorax_3H11:Ac3H11_4818 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
31% identity, 91% coverage: 9:218/230 of query aligns to 2:206/207 of 1h2fA
- active site: R8 (= R15), H9 (= H16), N15 (= N22), R58 (= R67), E82 (= E95), H150 (= H163)
- binding phosphate ion: T2 (= T9), T3 (≠ E10), G142 (= G155), E143 (≠ Q156)
- binding trivanadate: R8 (= R15), H9 (= H16), N15 (= N22), Q21 (= Q28), R58 (= R67), E82 (= E95), H150 (= H163), G151 (= G164), V152 (≠ G165)
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
31% identity, 91% coverage: 9:218/230 of query aligns to 2:206/207 of 1h2eA
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
35% identity, 69% coverage: 11:168/230 of query aligns to 6:152/257 of Q7ZVE3
- H11 (= H16) active site, Tele-phosphohistidine intermediate
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
25% identity, 91% coverage: 8:216/230 of query aligns to 1:203/207 of 4ij6A
- active site: R8 (= R15), A9 (≠ H16), N15 (= N22), R58 (= R67), E82 (= E95), H150 (= H163)
- binding phosphoserine: R8 (= R15), Q21 (= Q28), R58 (= R67), E82 (= E95), H85 (≠ F98), H150 (= H163), T151 (≠ G164)
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 68% coverage: 11:167/230 of query aligns to 10:167/211 of P36623
- T37 (= T38) modified: Phosphothreonine
- S62 (= S63) modified: Phosphoserine
- Y96 (≠ F98) modified: Phosphotyrosine
- S166 (≠ V166) modified: Phosphoserine
Q9NQ88 Fructose-2,6-bisphosphatase TIGAR; TP53-induced glycolysis and apoptosis regulator; TP53-induced glycolysis regulatory phosphatase; EC 3.1.3.46 from Homo sapiens (Human) (see 4 papers)
34% identity, 61% coverage: 11:151/230 of query aligns to 6:141/270 of Q9NQ88
- H11 (= H16) mutation to A: Abolishes the ability to lower cellular fructose-2,6-bisphosphate levels, to inhibit the glycolytic activity, to reduce levels of ROS, to increase oxygen consumption and to protect toward hypoxic cell death; when associated with A-11 and A-102. Retains the ability to interact and enhance HK2 activity, to localize to the mitochondria, to limit mitochondrial ROS level increase during hypoxia and to rescued partially crypt growth; when associated with A-102 and A-198. Loss of the ability to protect against cell death during hypoxia; when associated with A-102; A-198 and 258-N--D-261 Del.
- E102 (≠ D108) mutation to A: Abolishes the ability to lower cellular fructose-2,6-bisphosphate levels, to inhibit the glycolytic activity, to reduce levels of ROS, to increase oxygen consumption and to protect toward hypoxic cell death; when associated with A-11 and A-198. Retains the ability to interact and enhance HK2 activity, to localize to the mitochondria, to limit mitochondrial ROS level increase during hypoxia and to rescued partially crypt growth; when associated with A-11 and A-198. Loss of the ability to protect against cell death during hypoxia; when associated with A-11; A-198 and 258-N--D-261 Del.
Sites not aligning to the query:
- 198 H→A: Abolishes the ability to lower cellular fructose-2,6-bisphosphate levels, to inhibit the glycolytic activity, to reduce levels of ROS, to increase oxygen consumption and to protect toward hypoxic cell death; when associated with A-11 and A-102. Retains the ability to interact and enhance HK2 activity, to localize to the mitochondria, to limit mitochondrial ROS level increase during hypoxia and to rescued partially crypt growth; when associated with A-11 and A-102. Loss of the ability to protect against cell death during hypoxia; when associated with A-11; A-102 and 258-N--D-261 Del.
- 258:261 mutation Missing: Inhibits the ability to interact and enhance HK2 activity, to localize to the mitochondria, to protect against the decrease of mitochondrial membrane potential and to limit mitochondrial ROS level increase during hypoxia. Does not abolish the ability to lower cellular fructose-2,6-bisphosphate levels during hypoxia. Loss of the ability to protect against cell death during hypoxia; when associated with A-11; A-102 and A-198.
P36136 Sedoheptulose 1,7-bisphosphatase; EC 3.1.3.37 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 90% coverage: 11:217/230 of query aligns to 8:228/271 of P36136
- R12 (= R15) binding ; mutation to A: Impairs catalytic activity.
- H13 (= H16) active site, Tele-phosphohistidine intermediate; mutation to A: Impairs catalytic activity.
- T16 (= T19) mutation to A: Impairs catalytic activity.
- S19 (≠ N22) mutation to A: Leads to reduced substrate affinity.
- Y24 (≠ F27) mutation to A: Leads to low activity and reduced substrate affinity.
- YT 24:25 (≠ FQ 27:28) binding
- S65 (= S63) mutation to A: Leads to low activity and reduced substrate affinity.
- R69 (= R67) binding ; mutation to A: Leads to reduced substrate affinity.
- E99 (= E95) mutation to A: Impairs catalytic activity.
- EWEY 99:102 (≠ EQAF 95:98) binding
- Y102 (≠ F98) mutation to A: Impairs catalytic activity.
- W131 (= W120) mutation to A: Leads to reduced substrate affinity.
- H176 (= H163) mutation to A: Impairs catalytic activity.
- H178 (≠ G165) mutation to A: Leads to low activity and reduced substrate affinity.
- R181 (≠ D168) binding ; mutation to A: Leads to reduced substrate affinity.
Sites not aligning to the query:
3lg2A A ykr043c/ fructose-1,6-bisphosphate product complex following ligand soaking (see paper)
25% identity, 90% coverage: 11:217/230 of query aligns to 6:226/269 of 3lg2A
Sites not aligning to the query:
3oi7A Structure of the structure of the h13a mutant of ykr043c in complex with sedoheptulose-1,7-bisphosphate (see paper)
25% identity, 90% coverage: 11:217/230 of query aligns to 5:225/260 of 3oi7A
- active site: A10 (≠ H16), R66 (= R67), E96 (= E95)
- binding magnesium ion: T13 (= T19), T22 (≠ Q28), R66 (= R67)
- binding 1,7-di-O-phosphono-beta-D-altro-hept-2-ulofuranose: R9 (= R15), Y21 (≠ F27), T22 (≠ Q28), R66 (= R67), E96 (= E95), Y99 (≠ F98), H173 (= H163), H175 (≠ G165), R178 (≠ D168)
3ll4A Structure of the h13a mutant of ykr043c in complex with fructose-1,6- bisphosphate (see paper)
25% identity, 90% coverage: 11:217/230 of query aligns to 6:226/261 of 3ll4A
- active site: A11 (≠ H16), R67 (= R67), E97 (= E95)
- binding 1,6-fructose diphosphate (linear form): R10 (= R15), Y22 (≠ F27), T23 (≠ Q28), R67 (= R67), E97 (= E95), H174 (= H163), G175 (= G164), H176 (≠ G165), R179 (≠ D168)
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
43% identity, 30% coverage: 8:77/230 of query aligns to 1:70/247 of P00950
- M1 (= M8) modified: Initiator methionine, Removed
- 8:15 (vs. 15:22, 63% identical) binding
- H9 (= H16) active site, Tele-phosphohistidine intermediate
- TG 21:22 (≠ QG 28:29) binding
- R60 (= R67) binding
Sites not aligning to the query:
- 87:90 binding
- 98 binding
- 114:115 binding
- 169 K→P: Causes dissociation of the homotetramer to dimers at low concentrations.
- 182 H→A: Reduces kcat of the mutase reaction 10000-fold.
- 183:184 binding
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
43% identity, 30% coverage: 10:77/230 of query aligns to 2:69/234 of 5pgmE
Sites not aligning to the query:
1bq4A Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate (see paper)
43% identity, 30% coverage: 10:77/230 of query aligns to 2:69/234 of 1bq4A
Sites not aligning to the query:
1bq3A Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate (see paper)
43% identity, 30% coverage: 10:77/230 of query aligns to 2:69/234 of 1bq3A
Sites not aligning to the query:
1qhfA Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a (see paper)
43% identity, 30% coverage: 10:77/230 of query aligns to 2:69/240 of 1qhfA
Sites not aligning to the query:
7n3rB The ternary complex of human bisphosphoglycerate mutase with 3- phosphoglycerate and 2-phosphoglycolate (see paper)
29% identity, 59% coverage: 10:144/230 of query aligns to 3:136/239 of 7n3rB
2f90A Crystal structure of bisphosphoglycerate mutase in complex with 3-phosphoglycerate and alf4- (see paper)
29% identity, 59% coverage: 10:144/230 of query aligns to 3:136/254 of 2f90A
Sites not aligning to the query:
2h4zA Human bisphosphoglycerate mutase complexed with 2,3- bisphosphoglycerate (see paper)
29% identity, 59% coverage: 10:144/230 of query aligns to 4:137/255 of 2h4zA
- active site: H10 (= H16), R61 (= R67), E88 (= E95)
- binding (2R)-2,3-diphosphoglyceric acid: R9 (= R15), H10 (= H16), C22 (≠ Q28), S23 (≠ G29), R61 (= R67), E88 (= E95), Y91 (≠ F98), R99 (≠ V106), R115 (= R122), R116 (≠ F123)
Sites not aligning to the query:
P07738 Bisphosphoglycerate mutase; BPGM; 2,3-bisphosphoglycerate mutase, erythrocyte; 2,3-bisphosphoglycerate synthase; 2,3-diphosphoglycerate mutase; DPGM; BPG-dependent PGAM; EC 5.4.2.4; EC 5.4.2.11 from Homo sapiens (Human) (see 5 papers)
29% identity, 59% coverage: 10:144/230 of query aligns to 5:138/259 of P07738
- K5 (≠ E10) modified: carbohydrate, N-linked (Glc) (glycation) lysine; in vitro
- 10:17 (vs. 15:22, 75% identical) binding
- H11 (= H16) active site, Tele-phosphohistidine intermediate
- K18 (≠ R23) modified: carbohydrate, N-linked (Glc) (glycation) lysine; in vitro
- CS 23:24 (≠ QG 28:29) binding
- K29 (≠ P34) Not glycated
- K43 (≠ E48) modified: carbohydrate, N-linked (Glc) (glycation) lysine; in vitro
- K46 (≠ A51) Not glycated
- R62 (= R67) binding
- E89 (= E95) active site, Proton donor/acceptor
- ERHY 89:92 (≠ EQAF 95:98) binding
- R90 (≠ Q96) to C: in ECYT8; mutation identified at protein level; marked decrease in synthase and mutase activities; no effect on phosphatase activity; dbSNP:rs121964925
- R100 (≠ V106) binding
- RR 116:117 (≠ RF 122:123) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 3 modified: carbohydrate, N-linked (Glc) (glycation) lysine; in vitro
- 143 Not glycated
- 159 modified: carbohydrate, N-linked (Glc) (glycation) lysine
- 181 Not glycated
- 188 Transition state stabilizer
- 189:190 binding
- 197 modified: carbohydrate, N-linked (Glc) (glycation) lysine; in vitro
- 246 Not glycated
- 247 Not glycated
- 253 Not glycated
- 258 Not glycated
- 259 Not glycated
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
32% identity, 50% coverage: 8:122/230 of query aligns to 3:117/250 of P62707
- 10:17 (vs. 15:22, 75% identical) binding
- H11 (= H16) active site, Tele-phosphohistidine intermediate
- K18 (≠ R23) modified: N6-acetyllysine
- TG 23:24 (≠ QG 28:29) binding
- E89 (= E95) active site, Proton donor/acceptor
- ERHY 89:92 (≠ EQAF 95:98) binding
- K100 (≠ V106) binding ; modified: N6-acetyllysine
- K106 (≠ D112) modified: N6-acetyllysine
- RR 116:117 (≠ LR 121:122) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 184 Transition state stabilizer
- 185:186 binding
Query Sequence
>Ac3H11_4818 FitnessBrowser__acidovorax_3H11:Ac3H11_4818
MHSIIERMTELILIRHGETDWNRELRFQGHVDVPLNATGHEQARRLAERLAAEKLVVDHL
VCSDLIRTRQTATPSLQVLFPQASIDTLTDSALREQAFGVVDGKRVDDVKQDHADAWNQW
LRFEADYGMPGGETTRQFHTRVMNAVYRIAQQHAGQKVMVVTHGGVLDMIWRTARGTGLD
GPRQSDIPNAGLNRVRVSGEAVEVLDWADVRHLADLPEQPVYDQTKLVVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory