Comparing Ac3H11_545 FitnessBrowser__acidovorax_3H11:Ac3H11_545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ilvB Structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. Sirexaa-e (see paper)
38% identity, 63% coverage: 53:194/225 of query aligns to 5:132/157 of 4ilvB
3pckM Structure of protocatechuate 3,4-dioxygenase complexed with 6- hydroxynicotinic acid n-oxide (see paper)
38% identity, 57% coverage: 57:185/225 of query aligns to 45:181/233 of 3pckM
Sites not aligning to the query:
3pcjM Structure of protocatechuate 3,4-dioxygenase complexed with 2- hydroxyisonicotinic acid n-oxide (see paper)
38% identity, 57% coverage: 57:185/225 of query aligns to 45:181/233 of 3pcjM
Sites not aligning to the query:
3pciM Structure of protocatechuate 3,4-dioxygenase complexed with 3-iodo-4- hydroxybenzoate (see paper)
38% identity, 57% coverage: 57:185/225 of query aligns to 45:181/233 of 3pciM
3pchM Structure of protocatechuate 3,4-dioxygenase complexed with 3-chloro- 4-hydroxybenzoate (see paper)
38% identity, 57% coverage: 57:185/225 of query aligns to 45:181/233 of 3pchM
Sites not aligning to the query:
3pcgM Structure of protocatechuate 3,4-dioxygenase complexed with the inhibitor 4-hydroxyphenylacetate (see paper)
38% identity, 57% coverage: 57:185/225 of query aligns to 45:181/233 of 3pcgM
Sites not aligning to the query:
3pcfM Structure of protocatechuate 3,4-dioxygenase complexed with 3-fluro-4- hydroxybenzoate (see paper)
38% identity, 57% coverage: 57:185/225 of query aligns to 45:181/233 of 3pcfM
Sites not aligning to the query:
3pceM Structure of protocatechuate 3,4-dioxygenase complexed with 3- hydroxyphenylacetate (see paper)
38% identity, 57% coverage: 57:185/225 of query aligns to 45:181/233 of 3pceM
Sites not aligning to the query:
3pcbM Structure of protocatechuate 3,4-dioxygenase complexed with 3- hydroxybenzoate (see paper)
38% identity, 57% coverage: 57:185/225 of query aligns to 45:181/233 of 3pcbM
Sites not aligning to the query:
P00437 Protocatechuate 3,4-dioxygenase beta chain; 3,4-PCD; EC 1.13.11.3 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
41% identity, 44% coverage: 86:185/225 of query aligns to 76:185/239 of P00437
Sites not aligning to the query:
4whqF Alkylperoxo reaction intermediate trapped in protocatechuate 3,4- dioxygenase (pseudomonas putida) at ph 6.5 (see paper)
41% identity, 44% coverage: 86:185/225 of query aligns to 75:184/236 of 4whqF
Sites not aligning to the query:
4whrB Anhydride reaction intermediate trapped in protocatechuate 3,4- dioxygenase (pseudomonas putida) at ph 8.5 (see paper)
41% identity, 44% coverage: 86:185/225 of query aligns to 75:184/238 of 4whrB
Sites not aligning to the query:
4whqB Alkylperoxo reaction intermediate trapped in protocatechuate 3,4- dioxygenase (pseudomonas putida) at ph 6.5 (see paper)
41% identity, 44% coverage: 86:185/225 of query aligns to 75:184/238 of 4whqB
Sites not aligning to the query:
3lxvM Tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis
37% identity, 57% coverage: 57:185/225 of query aligns to 45:184/238 of 3lxvM
Sites not aligning to the query:
3lktM Tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis
37% identity, 57% coverage: 57:185/225 of query aligns to 45:184/238 of 3lktM
3mv4M Axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
39% identity, 44% coverage: 86:185/225 of query aligns to 75:184/238 of 3mv4M
3mi5M Axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
39% identity, 44% coverage: 86:185/225 of query aligns to 75:184/238 of 3mi5M
3mflM Axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
39% identity, 44% coverage: 86:185/225 of query aligns to 75:184/238 of 3mflM
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
30% identity, 72% coverage: 54:214/225 of query aligns to 103:273/312 of 5vxtB
2buqB Crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. Adp1 in complex with catechol (see paper)
34% identity, 60% coverage: 50:184/225 of query aligns to 36:181/238 of 2buqB
>Ac3H11_545 FitnessBrowser__acidovorax_3H11:Ac3H11_545
MPVHTGSTPSSPRPAPAAVPTRRRLLRQGLWGSALVVAPALVPAALAQGALTPTPRQTEG
PYYPVRFPSDSDGDLLRNGLMRYVDGQPVWVEGRVTDMQGVPLAGGTVEIWQCDADGHYH
HPGDGNKAAPAFQGFGRVVLGRDGRYRFRTIRPAPYTGRTPHIHFKVRLPDRELLTTQMY
VAGNPGNTSDFLWSRLSAAERAALTVPFAPSADGVRAEFALVVQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory