Comparing Ac3H11_693 FitnessBrowser__acidovorax_3H11:Ac3H11_693 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
28% identity, 88% coverage: 41:416/428 of query aligns to 21:357/373 of 4v15A
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
27% identity, 88% coverage: 37:411/428 of query aligns to 20:366/398 of 7yqaB
6qkbA Crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans (see paper)
24% identity, 72% coverage: 37:346/428 of query aligns to 23:313/384 of 6qkbA
Sites not aligning to the query:
A1B8Z1 3-hydroxy-D-aspartate aldolase; beta-hydroxyaspartate aldolase; EC 4.1.3.41 from Paracoccus denitrificans (strain Pd 1222) (see paper)
24% identity, 72% coverage: 37:346/428 of query aligns to 26:316/387 of A1B8Z1
Sites not aligning to the query:
>Ac3H11_693 FitnessBrowser__acidovorax_3H11:Ac3H11_693
MTDDFLLDYRCKGYPLHATPCRPADLGQRGWNVLAGDLPLPIAVIRESALAHNLAWMQAY
AERKGVALAPHGKTTLSPELFAQQLQAGAWGLTFATVYQLSVGVDAGARRAIIANQVLCD
ADLDGLHALLQRHADLRVWFLIDSLAQLRCIEDWAERRGHTARGERRLDSLLEMGVQGQR
TGCRTLEEALALAQAMAQSPAVQLGGVECYEGGVARCDSEHDAREVTALVRRVTEVARAC
DAQDLFADAEILLTAGGSAVFDLVIPLLRTQGLSKPVLGVLRSGCYITHDHGNYQRFLKH
VEQREGLDASLRPALEVWTLVQSVPEPGLALLTGGRRDVSYDLEMPVPVRWAPRHERRAA
STPTGWTVSALNDHHAYLRYDPAADPAPAVGDLVALGISHPCTTFDKWRWLPVVDDEGTI
TRAISTRF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory