Comparing BPHYT_RS01855 FitnessBrowser__BFirm:BPHYT_RS01855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
64% identity, 98% coverage: 3:361/368 of query aligns to 2:361/366 of 3dmeA
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
30% identity, 94% coverage: 17:363/368 of query aligns to 16:403/412 of 8w7fB
Sites not aligning to the query:
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
30% identity, 94% coverage: 17:363/368 of query aligns to 16:401/410 of 8w78A
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 60% coverage: 2:223/368 of query aligns to 48:267/866 of Q9UI17
Sites not aligning to the query:
Q9VW97 Possible lysine-specific histone demethylase 1; EC 1.-.-.- from Drosophila melanogaster (Fruit fly) (see paper)
47% identity, 13% coverage: 5:53/368 of query aligns to 266:316/890 of Q9VW97
Sites not aligning to the query:
>BPHYT_RS01855 FitnessBrowser__BFirm:BPHYT_RS01855
MDQIECVVIGAGVIGLAVARALAARGRDVIVLEAAEAIGVGTSSRNSEVIHAGIYYPRGS
LKAALCVRGREMLYDYCVERNVPHSRCGKLLVATSRNQIPQLESIMAKGRDNGVLDLMRI
SGDQAQALEPALECVEAVFSPQTGIVDSHQLMLALQGDAERDGAVCAFHAPVKAIEASNG
RFIINVGGGAPTTISAACVINSAGLQANALARRIRGLDARHVPPLYLARGNYFSISGRAP
FSRLIYPMPNEAGLGVHLTIDLGGQARFGPDVEWVDAINYDVDPRRAESFYAAIRTYWPA
LPDDALQPAYAGIRPKLSGPGEPAADFVIQGPAAHGVRGLVNLFGIESPGLTASLAIAQR
VCELSGRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory