Comparing BPHYT_RS02320 FitnessBrowser__BFirm:BPHYT_RS02320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
36% identity, 97% coverage: 5:258/262 of query aligns to 6:259/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 99% coverage: 1:260/262 of query aligns to 2:265/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 99% coverage: 1:260/262 of query aligns to 2:259/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 99% coverage: 1:260/262 of query aligns to 2:262/265 of 6eb3A
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
28% identity, 96% coverage: 9:260/262 of query aligns to 14:269/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
28% identity, 96% coverage: 9:260/262 of query aligns to 14:269/274 of 4uhdA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
28% identity, 96% coverage: 9:260/262 of query aligns to 14:269/278 of 4uhfA
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
23% identity, 95% coverage: 10:259/262 of query aligns to 11:267/269 of 5h3hB
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
24% identity, 98% coverage: 3:259/262 of query aligns to 45:305/310 of 6i8wB
Sites not aligning to the query:
1q0zA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma) (see paper)
27% identity, 82% coverage: 29:243/262 of query aligns to 29:278/297 of 1q0zA
1q0rA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin t (dcmat) (see paper)
27% identity, 82% coverage: 29:243/262 of query aligns to 29:278/297 of 1q0rA
3b12A Crystal structure of the fluoroacetate dehalogenase d104 mutant from burkholderia sp. Fa1 in complex with fluoroacetate (see paper)
35% identity, 39% coverage: 18:118/262 of query aligns to 23:128/294 of 3b12A
Sites not aligning to the query:
Q1JU72 Fluoroacetate dehalogenase; EC 3.8.1.3 from Burkholderia sp. (see paper)
35% identity, 39% coverage: 18:118/262 of query aligns to 23:128/304 of Q1JU72
Sites not aligning to the query:
Q86WA6 Valacyclovir hydrolase; VACVase; Valacyclovirase; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Breast epithelial mucin-associated antigen; MCNAA; EC 3.1.-.- from Homo sapiens (Human) (see 2 papers)
24% identity, 98% coverage: 2:259/262 of query aligns to 43:291/291 of Q86WA6
Sites not aligning to the query:
2ociA Crystal structure of valacyclovir hydrolase complexed with a product analogue (see paper)
24% identity, 98% coverage: 2:259/262 of query aligns to 6:254/254 of 2ociA
2ocgA Crystal structure of human valacyclovir hydrolase (see paper)
24% identity, 98% coverage: 2:259/262 of query aligns to 6:254/254 of 2ocgA
5z7xA Crystal structure of striga hermonthica htl4 (shhtl4) (see paper)
24% identity, 78% coverage: 27:230/262 of query aligns to 25:235/270 of 5z7xA
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
24% identity, 98% coverage: 1:258/262 of query aligns to 13:283/286 of P47229
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
24% identity, 98% coverage: 1:258/262 of query aligns to 12:282/285 of 2og1A
2rhwA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda (see paper)
24% identity, 98% coverage: 1:258/262 of query aligns to 10:280/283 of 2rhwA
>BPHYT_RS02320 FitnessBrowser__BFirm:BPHYT_RS02320
MQVNINGIETRYVLSNEGGGPWLTFIHQLGGDLSVWDQLAGYFRDDYTVLRYDVRGHGKT
AASSAPFGIADLSHDLATLLDALGAPTTHLVGMSMGGMIAQQFTLDHPTRVDSLTIADSS
GGTPQEARATWDQRAATARRDGMVSLVPATLSRWLTPDFQAAHPEAVEQIRDVLTNTLSE
GYAMACEALRDFDVRSKLGAIRCPTLTVAGRHDTGTPPASTQAIADAIEGARFELLDAAH
LAPIEQSHRFAALLETFLERPV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory