Comparing BPHYT_RS02460 FitnessBrowser__BFirm:BPHYT_RS02460 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 71% coverage: 25:213/265 of query aligns to 33:224/378 of P69874
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 72% coverage: 23:213/265 of query aligns to 40:239/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 72% coverage: 23:213/265 of query aligns to 40:239/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
38% identity, 72% coverage: 23:213/265 of query aligns to 40:239/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
38% identity, 72% coverage: 24:213/265 of query aligns to 21:219/375 of 2d62A
3d31A Modbc from methanosarcina acetivorans (see paper)
37% identity, 72% coverage: 22:213/265 of query aligns to 13:204/348 of 3d31A
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 72% coverage: 24:213/265 of query aligns to 20:221/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 72% coverage: 24:213/265 of query aligns to 20:221/230 of 1l2tA
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 73% coverage: 21:213/265 of query aligns to 13:208/384 of 8hplC
Sites not aligning to the query:
1g291 Malk (see paper)
35% identity, 86% coverage: 24:252/265 of query aligns to 18:268/372 of 1g291
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 71% coverage: 25:213/265 of query aligns to 23:218/226 of 5xu1B
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 72% coverage: 22:213/265 of query aligns to 17:211/393 of P9WQI3
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 72% coverage: 24:213/265 of query aligns to 18:210/362 of 8hprD
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 72% coverage: 24:213/265 of query aligns to 18:210/363 of 8hprC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 84% coverage: 11:232/265 of query aligns to 10:243/343 of P30750
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 78% coverage: 23:230/265 of query aligns to 17:230/369 of P19566
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 84% coverage: 11:232/265 of query aligns to 11:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 84% coverage: 11:232/265 of query aligns to 11:244/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 84% coverage: 11:232/265 of query aligns to 11:244/344 of 6cvlD
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 78% coverage: 23:230/265 of query aligns to 16:229/374 of 2awnB
Sites not aligning to the query:
>BPHYT_RS02460 FitnessBrowser__BFirm:BPHYT_RS02460
MSGLEIRRLHVAYEGARGAAPHVALADVDLRIEPGEFVVALGASGCGKTTLLNCIAGFIP
PTEGEVRLNGEPVLGPGADRGVVFQKYALMPWLDVLDNVALGLRFQRVPKAERERIALDM
LKLVGLEKHARSRVYALSGGMQQRVGIARALASDPQVLLMDEPMGALDAMTRESMQELVL
DVWGRTRKTVFFITHSVEEALFLATRLVVMTPGPGRIADSYDLPFARRFLQTRDARAVKS
SVDFIEWRERLVRRLHERKQDEVLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory