SitesBLAST
Comparing BPHYT_RS03795 FitnessBrowser__BFirm:BPHYT_RS03795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
39% identity, 93% coverage: 13:436/454 of query aligns to 12:437/448 of Q51955
- D41 (= D42) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D45) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (≠ S86) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D90) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G93) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R125) mutation to A: Abolishes 4-HBA transport.
- E144 (= E145) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R184) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (≠ E322) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ V327) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R385) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R397) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
35% identity, 96% coverage: 13:449/454 of query aligns to 5:441/452 of Q5EXK5
- D82 (= D90) mutation to A: Loss of activity.
- V311 (≠ W319) mutation to W: Loss of activity.
- D314 (≠ E322) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
35% identity, 91% coverage: 34:447/454 of query aligns to 19:398/403 of P77589
- E27 (≠ D42) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D90) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ W319) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R323) mutation to D: Lack of 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
28% identity, 84% coverage: 33:414/454 of query aligns to 44:403/444 of Q8NLB7
- D54 (= D42) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D45) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R91) mutation to A: Loss of transport activity.
- W309 (= W319) mutation to V: Loss of transport activity.
- D312 (≠ E322) mutation to A: Loss of transport activity.
- R313 (= R323) mutation to A: Loss of transport activity.
- I317 (≠ V327) mutation I->H,Y: Loss of transport activity.
- R386 (= R397) mutation to A: Loss of transport activity.
Q9NSA0 Solute carrier family 22 member 11; Organic anion transporter 4; OAT4; Organic anion:dicarboxylate exchanger OAT4 from Homo sapiens (Human) (see 3 papers)
28% identity, 78% coverage: 55:406/454 of query aligns to 127:482/550 of Q9NSA0
- G241 (= G166) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H305 (vs. gap) mutation to A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-469.
- G400 (≠ I321) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H469 (≠ L393) mutation to A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-305.
Sites not aligning to the query:
- 39 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface location; when associated with Q-56; Q-63 and Q-99.
- 47 H→A: Reduced cell surface expression and estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-52; A-83; A-305 and A-469.
- 52 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-83; A-305 and A-469.
- 56 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-63 and Q-99.
- 63 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-99.
- 83 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-305 and A-469.
- 99 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-63.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 50% coverage: 14:239/454 of query aligns to 151:383/742 of Q02563
- DMCLS 196:200 (≠ EWHVS 59:63) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 (vs. 184:184, 0% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
Q4U2R8 Solute carrier family 22 member 6; Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1 from Homo sapiens (Human) (see 6 papers)
28% identity, 84% coverage: 55:436/454 of query aligns to 119:503/563 of Q4U2R8
- Y230 (≠ L165) mutation to A: Loss of membrane protein expression and little uptake of cidofovir.
- K431 (≠ G361) mutation to A: Decrease in the level of membrane protein expression and 70 % loss of PAH uptake.
- F438 (≠ Q369) mutation to A: Decrease in the level of membrane protein expression, 70 % loss of PAH uptake, increased affinity for cidofovir, lower Vmax for PAH, and lower Km and Vmax for cidofovir.
Sites not aligning to the query:
- 7 L → P: in dbSNP:rs1415632329
- 30 L→A: Complete loss of PAH transport activity.
- 36 T→A: Complete loss of PAH transport activity.
- 39 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Complete loss of PAH transport activity.
- 50 R → H: lower Vmax; increase in substrate affinity and increase in the affinity for the nucleoside phosphonate analogs cidofovir, adefovir and tenofovir; dbSNP:rs11568626
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 92 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 104 P → L: in dbSNP:rs11568627
- 113 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q8VC69 Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; mNKT; Organic anion transporter 1; mOAT1; Renal organic anion transporter 1; mROAT1 from Mus musculus (Mouse) (see 2 papers)
28% identity, 83% coverage: 55:433/454 of query aligns to 113:494/545 of Q8VC69
- C122 (vs. gap) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- C183 (≠ I122) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- C434 (≠ A371) mutation to A: Decreased cell surface expression level and PAH transport activity. 80% decrease of PAH transport activity; when associated with A-49; A-122 and A-183. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402 and A-427.
Sites not aligning to the query:
- 39 N→Q: Complete loss of PAH transport activity.
- 49 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 86 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 107 modified: carbohydrate, N-linked (GlcNAc...) asparagine
O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
27% identity, 78% coverage: 53:406/454 of query aligns to 129:487/562 of O57379
- K394 (≠ G310) mutation to A: Reduced transport activity.
- R478 (= R397) mutation to D: Reduced transport activity.
Sites not aligning to the query:
- 34 H→I: Reduced transport activity.
Q9U539 Organic cation transporter 1; CeOCT1 from Caenorhabditis elegans (see paper)
25% identity, 91% coverage: 42:453/454 of query aligns to 127:551/585 of Q9U539
Sites not aligning to the query:
- 87 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9VCA2 Organic cation transporter protein from Drosophila melanogaster (Fruit fly) (see paper)
26% identity, 78% coverage: 55:406/454 of query aligns to 115:474/548 of Q9VCA2
Sites not aligning to the query:
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
24% identity, 48% coverage: 2:221/454 of query aligns to 125:356/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
24% identity, 48% coverage: 2:221/454 of query aligns to 125:356/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 57% coverage: 90:349/454 of query aligns to 93:363/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
23% identity, 74% coverage: 77:413/454 of query aligns to 157:489/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G133), W216 (≠ M136), Q240 (≠ S160), W353 (≠ Y279), Y360 (≠ I301), F378 (≠ W319), S381 (vs. gap), E385 (vs. gap), C449 (≠ N373), S469 (≠ L393)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
23% identity, 74% coverage: 77:413/454 of query aligns to 157:489/532 of 8et7A
Sites not aligning to the query:
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
24% identity, 73% coverage: 77:406/454 of query aligns to 158:483/554 of O15245
- L160 (= L79) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (= S108) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A139) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ V159) mutation to F: Decreased TEA uptake.
- P283 (= P206) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (≠ Q210) to G: in dbSNP:rs4646278
- P341 (≠ G259) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (= R260) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (≠ I301) mutation to F: Decreased TEA uptake.
- Y376 (≠ L316) mutation to F: Decreased TEA uptake.
- G401 (≠ A348) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (≠ L355) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (vs. gap) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (vs. gap) to I: in dbSNP:rs35956182
- V461 (≠ L384) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G388) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
O75751 Solute carrier family 22 member 3; Extraneuronal monoamine transporter; EMT; Organic cation transporter 3; OCT3 from Homo sapiens (Human) (see paper)
25% identity, 79% coverage: 77:436/454 of query aligns to 164:516/556 of O75751
- P289 (= P206) mutation to A: Decreased TEA uptake.
- V363 (≠ M289) mutation to F: Decreased TEA uptake.
- Y380 (≠ L306) mutation to F: Decreased TEA uptake.
O76082 Organic cation/carnitine transporter 2; High-affinity sodium-dependent carnitine cotransporter; Solute carrier family 22 member 5 from Homo sapiens (Human) (see 21 papers)
25% identity, 80% coverage: 41:404/454 of query aligns to 114:478/557 of O76082
- D115 (= D42) to G: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs386134192
- V123 (≠ G50) to G: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs748605096
- E131 (= E59) to D: in CDSP; uncertain significance; may affect splicing; reduces carnitine transport but the mutant retains 30% of wild-type activity
- A142 (≠ P69) to S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 25% of wild-type activity; dbSNP:rs151231558
- P143 (≠ V70) to L: in CDSP; carnitine transport reduced to less than 2% of wild-type; dbSNP:rs1178584184
- L144 (≠ F71) to F: in dbSNP:rs10040427
- V151 (vs. gap) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs386134193
- R169 (= R94) to P: in CDSP; loss of carnitine transport; to Q: in CDSP; loss of carnitine transport; dbSNP:rs121908889; to W: in CDSP; loss of carnitine transport; dbSNP:rs121908890
- V175 (≠ G100) to M: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs781721860
- M177 (vs. gap) to V: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs145068530
- M179 (vs. gap) to L: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs386134196
- L186 (= L107) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134197
- M205 (≠ L130) to R: in CDSP; loss of carnitine transport; dbSNP:rs796052033
- N210 (≠ I135) to S: in CDSP; loss of carnitine transport; dbSNP:rs386134198
- Y211 (≠ M136) to C: in CDSP; loss of carnitine transport; dbSNP:rs121908888
- A214 (= A139) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134199
- T219 (≠ G144) to K: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity
- S225 (≠ A150) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs386134205
- R227 (= R152) to H: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs185551386
- F230 (≠ R155) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs756650860
- S231 (≠ M156) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134206
- T232 (≠ M157) to M: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs114269482
- A240 (≠ L169) to T: in CDSP; reduces carnitine transport to less than 2% of wild-type activity
- G242 (= G171) to V: in CDSP; loss of carnitine transport; dbSNP:rs72552728
- P247 (≠ A176) to R: in CDSP; loss of carnitine transport
- R254 (vs. gap) to Q: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 30% of wild-type activity; dbSNP:rs200699819
- R257 (= R184) to W: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs386134203
- T264 (≠ A192) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs201262157; to R: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs201262157
- L269 (= L197) to P: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity
- S280 (= S208) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs386134208
- R282 (≠ Q210) to Q: in CDSP; reduces carnitine transport to 5% of wild-type activity; dbSNP:rs386134210
- W283 (≠ F211) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134211; to R: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs72552729
- A301 (= A226) to D: in CDSP; reduces carnitine transport to less-than-1% to 3% of wild-type activity; dbSNP:rs72552730
- I312 (≠ P233) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 70% of wild-type activity; dbSNP:rs77300588
- E317 (≠ T238) to K: in CDSP; uncertain significance; no effect on carnitine transport; dbSNP:rs774792831
- I348 (≠ A269) to T: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 60% of wild-type activity; dbSNP:rs150544263
- W351 (≠ F272) to R: in CDSP; loss of carnitine transport; dbSNP:rs68018207
- M352 (= M273) mutation to R: Loss of both carnitine and organic cation transport functionalities. No effect on protein expression.
- S355 (≠ I276) to L: in CDSP; reduces carnitine transport to less than 2% of wild-type activity; dbSNP:rs1385634398
- Y358 (= Y279) to N: in CDSP; loss of carnitine transport; dbSNP:rs61731073
- L363 (≠ N283) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134214
- L394 (= L317) natural variant: Missing (in CDSP; reduces carnitine transport to 5% of wild-type activity)
- P398 (≠ I321) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs144547521
- R399 (≠ E322) to Q: in CDSP; carnitine transport is reduced to less than 1% of normal; dbSNP:rs121908891; to W: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs267607054
- S412 (≠ A337) to G: in CDSP; uncertain significance; no effect on carnitine transport
- V439 (= V365) to G: in CDSP; reduces carnitine transport to less than 1% of wild-type activity
- T440 (≠ V366) to M: in CDSP; loss of carnitine transport; dbSNP:rs72552732
- A442 (≠ G368) to I: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs267607053
- F443 (≠ Q369) to V: in CDSP; reduces carnitine transport to less than 1% of wild-type
- V446 (= V372) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type; dbSNP:rs72552733
- Y447 (≠ N373) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134218
- V448 (≠ A374) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs386134219
- Y449 (≠ L375) to D: in CDSP; uncertain significance; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs11568514
- E452 (≠ H378) to K: in CDSP; reduces carnitine transport to less than 5% of wild-type; dbSNP:rs72552734
- P455 (= P381) to R: in CDSP; loss of carnitine transport; dbSNP:rs1408166345
- G462 (= G388) to V: in CDSP; reduces carnitine transport to less than 5% of wild-type
- S467 (≠ L393) to C: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs60376624
- T468 (≠ G394) to R: in CDSP; markedly reduced carnitine transport compared to the wild-type protein; less than 1% of wild-type activity; dbSNP:rs386134221
- S470 (≠ G396) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134222
- R471 (= R397) to H: in CDSP; reduces carnitine transport to less than 2% of wild-type; dbSNP:rs386134223; to P: in CDSP; loss of carnitine transport
- L476 (≠ I402) to R: in CDSP; loss of carnitine transport
- P478 (= P404) to L: in CDSP; loss of carnitine transport but stimulated organic cation transport; no effect on protein expression; dbSNP:rs72552735
Sites not aligning to the query:
- 12 G → S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs139203363
- 15 G → W: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs267607052
- 16 P → L: in CDSP; loss of carnitine transport
- 17 F → L: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs11568520
- 19 R → P: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs72552723
- 20 L → H: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs144020613
- 22 natural variant: Missing (in CDSP; reduces carnitine transport to less than 1% of normal)
- 26 S → N: in CDSP; carnitine transport reduced to less than 6% of wild-type; dbSNP:rs772578415
- 28 S → I: in CDSP; carnitine transport reduced to 1% of wild-type; dbSNP:rs72552724
- 32 N → S: in CDSP; carnitine transport reduced to less than 1% of wild-type; dbSNP:rs72552725
- 44 A → V: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs199689597
- 46 P → L: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs377767445; P → S: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs202088921
- 50 C → Y: in CDSP; loss of carnitine transport
- 57 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 66 T → P: in CDSP; carnitine transport reduced to 2% of wild-type
- 75 R → P: in CDSP; carnitine transport reduced to 2% of wild-type; dbSNP:rs757711838
- 83 R → L: in CDSP; loss of carnitine transport; dbSNP:rs72552726
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Reduces expression to 50%. No effect on carnitine transporter activity.
- 93 S → W: in CDSP; loss of carnitine transport; dbSNP:rs386134190
- 95 L → V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134191
- 96 G → A: in CDSP; carnitine transport reduced to 20% of wild-type; dbSNP:rs377767450
- 481 V → F: reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs11568513; V → I: in dbSNP:rs11568513
- 488 R → C: in CDSP; reduces carnitine transport to less than 10% of wild-type; dbSNP:rs377216516; R → H: in CDSP; uncertain significance; reduces carnitine transport to 40% of wild-type; dbSNP:rs28383481
- 507 L → S: in CDSP; reduces carnitine transport to 5% of wild-type; dbSNP:rs1157198543
- 508 F → L: in dbSNP:rs11568521
- 530 M → V: in dbSNP:rs11568524
- 549 P → S: reduces carnitine transport but the mutant retains more than 20% of wild-type activity; dbSNP:rs11568525
P39386 Multidrug resistance protein MdtM; Multidrug resistance transporter MdtM; MDR transporter MdtM; Multidrug transporter MdtM from Escherichia coli (strain K12) (see 3 papers)
28% identity, 27% coverage: 88:210/454 of query aligns to 71:193/410 of P39386
- R108 (= R125) mutation to K: Decreases resistance to ethidium bromide and chloramphenicol. Retains the ability to bind chloramphenicol.
Sites not aligning to the query:
- 22 D→A: Lack of activity. Retains the ability to bind chloramphenicol, but cannot confer resistance to ethidium bromide and chloramphenicol. Cannot grow at pH 9.5 and 9.75.
Query Sequence
>BPHYT_RS03795 FitnessBrowser__BFirm:BPHYT_RS03795
MSAKPAAAAANVIEVEQVLGETHHPAFQLLLLVLCGLCLVIDGFDAQAMGYVAPSVIGEW
HVSKAALGPVFSASLFGMLLGALGLSVLADRIGRRPVLIGSTFFFALSMLATPFVTTIPA
LIALRFITGLGLGCIMPNAMALVGEFSTPAHRVKRMMLVSCGFTLGAALGGFISAALIPA
YGWRAVFWVGGAVPLLLALAMLVALPESLQFLVLKGRSERALRWLAKFNPALPIDANTRL
VVREKGNGGAPVAELFRAGRGPVTLILWAISFMNLIDLYFLSNWLPTVMRDAGYSPSTAV
IVGTVLQTGGVVGTLLLGWFIERFGFVRVLFVCFAGAALAVGTIGTVAHALPWLLLVVFA
GGFCVVGGQPAVNALAGHFYPTTLRSTGIGWSLGIGRIGSVIGPLIGGQLIALNWSNAAL
FHAAALPVLCSALLVIALAAATRQRGQSPEPRTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory