SitesBLAST
Comparing BPHYT_RS04860 FitnessBrowser__BFirm:BPHYT_RS04860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 86% coverage: 10:250/280 of query aligns to 9:249/265 of P07821
- K50 (= K51) mutation to Q: Lack of activity.
- D172 (= D173) mutation to E: Lack of activity.
- E173 (= E174) mutation to A: Lack of activity.
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
35% identity, 85% coverage: 26:262/280 of query aligns to 13:245/248 of 4fi3C
- binding phosphoaminophosphonic acid-adenylate ester: R14 (≠ L27), N34 (= N47), G35 (= G48), G37 (= G50), K38 (= K51), S39 (≠ T52), T40 (= T53), R121 (= R144), Q125 (≠ S148), S127 (= S150), G129 (= G152), E130 (= E153), Q158 (≠ E174)
- binding magnesium ion: S39 (≠ T52), Q79 (= Q93)
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
37% identity, 79% coverage: 26:247/280 of query aligns to 13:230/231 of 1l7vC
1yqtA Rnase-l inhibitor (see paper)
30% identity, 69% coverage: 37:230/280 of query aligns to 288:460/515 of 1yqtA
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 8, 13, 33, 34, 36, 37, 38, 39, 274, 277
- binding magnesium ion: 38, 90
5yv5A Crystal structure of the complex of archaeal ribosomal stalk protein ap1 and archaeal ribosome recycling factor aabce1. (see paper)
30% identity, 69% coverage: 37:230/280 of query aligns to 291:463/517 of 5yv5A
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 11, 14, 16, 36, 37, 39, 40, 41, 42, 277, 280
- binding magnesium ion: 41, 93
- binding : 94, 97, 98, 100, 101, 151, 152, 155
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 81% coverage: 38:264/280 of query aligns to 52:274/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
31% identity, 81% coverage: 38:264/280 of query aligns to 52:274/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
32% identity, 69% coverage: 18:211/280 of query aligns to 10:195/249 of 4hluC
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
29% identity, 81% coverage: 28:254/280 of query aligns to 23:242/265 of 4hluA
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 71% coverage: 28:225/280 of query aligns to 16:205/348 of 3d31A
Sites not aligning to the query:
3bk7A Structure of the complete abce1/rnaase-l inhibitor protein from pyrococcus abysii (see paper)
31% identity, 68% coverage: 37:227/280 of query aligns to 367:536/593 of 3bk7A
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 87, 92, 112, 113, 114, 115, 116, 117, 118, 292, 353
- binding iron/sulfur cluster: 15, 16, 20, 25, 29, 30, 38, 39, 55, 56, 57, 58, 59, 61, 65, 70
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
28% identity, 81% coverage: 28:254/280 of query aligns to 23:240/263 of 4zirA
- binding phosphoaminophosphonic acid-adenylate ester: T42 (≠ N47), G45 (= G50), K46 (= K51), S47 (≠ T52), T48 (= T53), Q83 (= Q93), R132 (= R144), F136 (≠ S148), S138 (= S150), G139 (= G151), G140 (= G152), E141 (= E153)
- binding magnesium ion: S47 (≠ T52), Q83 (= Q93), D161 (= D173)
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
32% identity, 72% coverage: 38:238/280 of query aligns to 52:252/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (≠ N47), G62 (= G48), G64 (= G50), K65 (= K51), S66 (≠ T52), T67 (= T53), Q111 (≠ S100), K161 (≠ L147), Q162 (≠ S148), S164 (= S150), G166 (= G152), M167 (≠ E153), Q188 (≠ E174), H221 (= H207)
Sites not aligning to the query:
6tejB Structure of apo irtab devoid sid in complex with sybody syb_nl5 (see paper)
34% identity, 65% coverage: 23:205/280 of query aligns to 341:522/585 of 6tejB
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
27% identity, 75% coverage: 38:248/280 of query aligns to 28:235/241 of 4u00A
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
28% identity, 79% coverage: 11:231/280 of query aligns to 1:215/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
28% identity, 79% coverage: 11:231/280 of query aligns to 2:216/371 of P68187
- A85 (≠ V103) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ E121) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A129) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A132) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D134) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (= A139) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G152) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D173) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
28% identity, 79% coverage: 11:231/280 of query aligns to 1:215/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ A22), S37 (≠ N47), G38 (= G48), C39 (≠ A49), G40 (= G50), K41 (= K51), S42 (≠ T52), T43 (= T53), Q81 (≠ S100), R128 (= R144), A132 (≠ S148), S134 (= S150), G136 (= G152), Q137 (≠ E153), E158 (= E174), H191 (= H207)
- binding magnesium ion: S42 (≠ T52), Q81 (≠ S100)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
28% identity, 79% coverage: 11:231/280 of query aligns to 1:215/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ A22), G38 (= G48), C39 (≠ A49), G40 (= G50), K41 (= K51), S42 (≠ T52), T43 (= T53), R128 (= R144), S134 (= S150), Q137 (≠ E153)
- binding beryllium trifluoride ion: S37 (≠ N47), G38 (= G48), K41 (= K51), Q81 (≠ S100), S134 (= S150), G136 (= G152), H191 (= H207)
- binding magnesium ion: S42 (≠ T52), Q81 (≠ S100)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
28% identity, 79% coverage: 11:231/280 of query aligns to 1:215/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ A22), V17 (≠ L27), G38 (= G48), C39 (≠ A49), G40 (= G50), K41 (= K51), S42 (≠ T52), T43 (= T53), R128 (= R144), A132 (≠ S148), S134 (= S150), Q137 (≠ E153)
- binding tetrafluoroaluminate ion: S37 (≠ N47), G38 (= G48), K41 (= K51), Q81 (≠ S100), S134 (= S150), G135 (= G151), G136 (= G152), E158 (= E174), H191 (= H207)
- binding magnesium ion: S42 (≠ T52), Q81 (≠ S100)
Query Sequence
>BPHYT_RS04860 FitnessBrowser__BFirm:BPHYT_RS04860
MQTRHAPSHDATLGAQRLTLRAGARTLLDAFTHTFYAGEIWCIAGPNGAGKTTLLSTLAG
LLQPSAGHVELDGVRLADWPPLSLAQRRALMPQSAPDAFSASVLDIVMLNRFPHLTGWGW
EREADREAAHAALDLLGLAAFAARDVLSLSGGERQRVALAAVLCQDAPLLLLDEPLAHLD
LHHQIDCLEALAAWTRAPRRTVMFSCHDLNFARRFATHALLLDGAGGAYAGPVHDVLTPT
LASRAFGYPLLLIRDGEHEALIPAPRARHESPAGHDAPAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory