Comparing BPHYT_RS07330 FitnessBrowser__BFirm:BPHYT_RS07330 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
46% identity, 68% coverage: 92:298/306 of query aligns to 72:273/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
46% identity, 68% coverage: 92:298/306 of query aligns to 72:273/290 of 8gsrA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
38% identity, 97% coverage: 7:303/306 of query aligns to 4:300/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
38% identity, 97% coverage: 7:303/306 of query aligns to 5:301/303 of 8sutA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
34% identity, 100% coverage: 1:305/306 of query aligns to 2:276/277 of 6iymA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
39% identity, 68% coverage: 91:299/306 of query aligns to 12:209/216 of 6sbiA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
37% identity, 74% coverage: 79:304/306 of query aligns to 50:267/269 of 4dbhA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
41% identity, 61% coverage: 119:304/306 of query aligns to 76:248/252 of 3qdfA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
38% identity, 70% coverage: 90:304/306 of query aligns to 69:276/279 of 6v77B
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
37% identity, 68% coverage: 91:299/306 of query aligns to 13:210/218 of 6fogA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
37% identity, 68% coverage: 91:299/306 of query aligns to 18:215/224 of Q6P587
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
37% identity, 70% coverage: 90:304/306 of query aligns to 67:277/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
37% identity, 70% coverage: 90:304/306 of query aligns to 67:277/280 of 6j5xA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
35% identity, 69% coverage: 88:299/306 of query aligns to 21:226/233 of 6j5yA
1gttA Crystal structure of hpce (see paper)
39% identity, 60% coverage: 93:276/306 of query aligns to 225:392/421 of 1gttA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
34% identity, 75% coverage: 75:303/306 of query aligns to 46:260/265 of 3r6oA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
33% identity, 81% coverage: 59:306/306 of query aligns to 42:263/264 of 6jvwB
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
33% identity, 66% coverage: 92:293/306 of query aligns to 17:209/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
28% identity, 64% coverage: 91:287/306 of query aligns to 9:216/247 of 1nkqA
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
30% identity, 43% coverage: 142:274/306 of query aligns to 193:353/419 of P16930
Sites not aligning to the query:
>BPHYT_RS07330 FitnessBrowser__BFirm:BPHYT_RS07330
MTWFGIATYELNGRSGMGLAVGSKLYDAHAALNQIAPEAPLADVGTLIAGWETDGAAAVE
RFERAARAIEAGTLEIAALQGHALCVPFQPRRIFAAASNYYEHAREMGTELAPREESTPY
MFMKAETSVVPTLAEVVIPPHAERVDWEVELAVVIGKTGRHIAQQDAYDYIAGYTILNDV
SARDLNRRTDYPFKHDWFRGKSFDTFGPLGPWFVPRACIAEPQNLRMRLSVNGEMMQDGN
TSGMIFNIAEQIEYLSTILTLQPGDLIATGTPTGVGMGRGVYLKAGDVMVASIDGIGSIE
NPLVAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory