SitesBLAST
Comparing BPHYT_RS13885 FitnessBrowser__BFirm:BPHYT_RS13885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
30% identity, 95% coverage: 6:325/338 of query aligns to 1:333/340 of 4n54A
- active site: K96 (= K98), H183 (= H179)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R17), K96 (= K98), D156 (= D157), D179 (= D175), M180 (= M176), H183 (= H179), R238 (= R234), Y244 (= Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ F13), G9 (= G14), L10 (≠ A15), G11 (= G16), R12 (= R17), L13 (≠ I18), S35 (≠ D39), V36 (= V40), E40 (≠ A44), S73 (= S75), P74 (≠ S76), F77 (≠ T79), H78 (= H80), E95 (= E97), K96 (= K98), M125 (≠ Q126), F167 (vs. gap), F284 (= F280)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
27% identity, 97% coverage: 6:334/338 of query aligns to 3:340/342 of 3ceaA
- active site: K98 (= K98), H185 (= H179)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), G13 (= G16), R14 (= R17), L15 (≠ I18), L38 (≠ V40), Q42 (≠ A44), V74 (≠ C74), A75 (≠ S75), P76 (≠ S76), T77 (= T77), F79 (≠ T79), H80 (= H80), M83 (≠ L83), E97 (= E97), K98 (= K98), M127 (≠ Q126), F169 (vs. gap), H185 (= H179), F286 (= F279)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
29% identity, 98% coverage: 8:337/338 of query aligns to 3:332/339 of 4mjlD
- active site: K97 (= K98)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K98), H155 (≠ S155), N157 (≠ D157), D172 (= D175), T173 (≠ M176), H176 (= H179), Y236 (= Y240)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), A12 (≠ R17), M13 (≠ I18), D35 (= D39), I36 (≠ V40), V73 (≠ C74), S74 (= S75), H79 (= H80), E96 (= E97), K97 (= K98), M126 (≠ Q126), D172 (= D175), W274 (≠ F280), Y282 (= Y288)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
29% identity, 98% coverage: 8:337/338 of query aligns to 3:332/339 of 4mioD
- active site: K97 (= K98)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K98), H155 (≠ S155), N157 (≠ D157), D172 (= D175), T173 (≠ M176), H176 (= H179), Y236 (= Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R17), M13 (≠ I18), D35 (= D39), I36 (≠ V40), S74 (= S75), A78 (≠ T79), H79 (= H80), E96 (= E97), K97 (= K98), M126 (≠ Q126), D172 (= D175), W274 (≠ F280), Y282 (= Y288)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
29% identity, 98% coverage: 8:337/338 of query aligns to 3:332/339 of 4mioA
- active site: K97 (= K98)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), A12 (≠ R17), M13 (≠ I18), D35 (= D39), I36 (≠ V40), S74 (= S75), F75 (≠ S76), H79 (= H80), E96 (= E97), K97 (= K98), W274 (≠ F280), Y282 (= Y288)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
29% identity, 98% coverage: 8:337/338 of query aligns to 3:332/339 of 4minA
- active site: K97 (= K98)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), A12 (≠ R17), M13 (≠ I18), D35 (= D39), I36 (≠ V40), V73 (≠ C74), S74 (= S75), F75 (≠ S76), H79 (= H80), E96 (= E97), K97 (= K98), Y282 (= Y288)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
26% identity, 97% coverage: 7:334/338 of query aligns to 2:327/337 of 3nt5A
- active site: K97 (= K98), H176 (= H179)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K98), H155 (≠ S155), H176 (= H179), Y235 (= Y240)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G11 (= G16), A12 (≠ R17), I13 (= I18), D35 (= D39), V36 (= V40), S74 (= S75), W75 (≠ S76), G76 (≠ T77), E96 (= E97), K97 (= K98), Y280 (= Y288)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
26% identity, 97% coverage: 7:334/338 of query aligns to 2:327/337 of 3nt4A
- active site: K97 (= K98), H176 (= H179)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ S155), H176 (= H179), Y235 (= Y240), W272 (≠ F280)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), A12 (≠ R17), I13 (= I18), D35 (= D39), V36 (= V40), S74 (= S75), W75 (≠ S76), G76 (≠ T77), E96 (= E97), K97 (= K98), H176 (= H179)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
26% identity, 97% coverage: 7:334/338 of query aligns to 2:327/337 of 3nt2B
- active site: K97 (= K98), H176 (= H179)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G14), G11 (= G16), A12 (≠ R17), D35 (= D39), V36 (= V40), S74 (= S75), W75 (≠ S76), A78 (≠ T79), K97 (= K98), W272 (≠ F280), Y280 (= Y288)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
26% identity, 97% coverage: 7:334/338 of query aligns to 2:327/337 of 3nt2A
- active site: K97 (= K98), H176 (= H179)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G11 (= G16), A12 (≠ R17), I13 (= I18), D35 (= D39), V36 (= V40), S74 (= S75), W75 (≠ S76), G76 (≠ T77), A78 (≠ T79), H79 (= H80), E96 (= E97), K97 (= K98), H176 (= H179), Y280 (= Y288)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
26% identity, 97% coverage: 7:334/338 of query aligns to 2:327/337 of 4l8vA
- active site: K97 (= K98), H176 (= H179)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R17), I13 (= I18), S74 (= S75), W75 (≠ S76), H79 (= H80), E96 (= E97), K97 (= K98), M126 (≠ Q126), W272 (≠ F280), Y280 (= Y288)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
28% identity, 96% coverage: 7:330/338 of query aligns to 2:322/336 of 3ec7A
- active site: K97 (= K98), H176 (= H179)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M12 (≠ R17), I13 (= I18), D35 (= D39), I36 (≠ V40), R40 (≠ A44), T73 (≠ C74), A74 (≠ S75), S75 (= S76), N76 (≠ T77), H79 (= H80), E96 (= E97), K97 (= K98), M126 (≠ Q126), W271 (≠ F280), Y279 (= Y288)
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
29% identity, 93% coverage: 22:334/338 of query aligns to 27:347/349 of 6norA
- binding nicotinamide-adenine-dinucleotide: D44 (= D39), R45 (≠ V40), A80 (≠ C74), T81 (≠ S75), P82 (≠ S76), H86 (= H80), E103 (= E97), K104 (= K98), N132 (≠ Q126), T169 (≠ V163), W171 (≠ Y165), Y301 (= Y288)
Sites not aligning to the query:
8qc6A Crystal structure of NAD-dependent glycoside hydrolase from arthrobacter sp. U41 in complex with NAD+ and sulfoquinovose (sq) (see paper)
25% identity, 98% coverage: 3:334/338 of query aligns to 1:365/366 of 8qc6A
- binding nicotinamide-adenine-dinucleotide: H15 (≠ R17), M16 (≠ I18), D37 (= D39), P38 (≠ V40), S42 (≠ A44), A75 (≠ C74), S76 (= S75), P77 (≠ S76), N78 (≠ T77), H81 (= H80), E100 (= E97), K101 (= K98), E129 (≠ Q126), K166 (≠ P162), V167 (= V163), W170 (vs. gap), H315 (= H290)
- binding sulfoquinovose: K101 (= K98), Y130 (≠ R127), R160 (= R156), F163 (≠ G159), L164 (≠ A160), K166 (≠ P162), E183 (≠ D175), K184 (≠ M176), H187 (= H179), H315 (= H290)
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
24% identity, 97% coverage: 7:334/338 of query aligns to 1:338/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G16), H11 (≠ R17), M12 (≠ I18), D33 (= D39), P34 (≠ V40), T35 (≠ N41), S38 (≠ A44), A71 (≠ C74), S72 (= S75), P73 (≠ S76), N74 (≠ T77), H77 (= H80), E96 (= E97), K97 (= K98), E125 (≠ Q126), K162 (≠ P162), V163 (= V163), W166 (vs. gap)
8qc8B Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
24% identity, 98% coverage: 5:334/338 of query aligns to 3:365/367 of 8qc8B
- binding nicotinamide-adenine-dinucleotide: H15 (≠ R17), M16 (≠ I18), D37 (= D39), P38 (≠ V40), T39 (≠ N41), S42 (≠ A44), A75 (≠ C74), S76 (= S75), P77 (≠ S76), N78 (≠ T77), H81 (= H80), E100 (= E97), K101 (= K98), E129 (≠ Q126), K166 (≠ P162), V167 (= V163), W170 (vs. gap), H315 (= H290)
8qc2A Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ and sulfoquinovose (sq) (see paper)
24% identity, 98% coverage: 5:334/338 of query aligns to 1:363/363 of 8qc2A
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), H13 (≠ R17), M14 (≠ I18), D35 (= D39), P36 (≠ V40), T37 (≠ N41), S40 (≠ A44), A73 (≠ C74), S74 (= S75), P75 (≠ S76), N76 (≠ T77), H79 (= H80), E98 (= E97), K99 (= K98), E127 (≠ Q126), K164 (≠ P162), V165 (= V163), W168 (vs. gap), H313 (= H290)
- binding sulfoquinovose: K99 (= K98), Y128 (≠ R127), R158 (= R156), F161 (≠ G159), L162 (≠ A160), K164 (≠ P162), E181 (≠ D175), H185 (= H179), H313 (= H290)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
27% identity, 94% coverage: 17:334/338 of query aligns to 2:328/332 of 2glxA
- active site: K93 (= K98), H179 (= H179)
- binding acetate ion: K93 (= K98), H179 (= H179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (≠ H22), A8 (= A23), S9 (≠ A24), T10 (≠ N25), I11 (≠ L26), S32 (≠ D39), T33 (≠ V40), R37 (≠ A44), S69 (≠ C74), T70 (≠ S75), N72 (≠ T77), H75 (= H80), E92 (= E97), K93 (= K98), H121 (≠ Q126), W161 (vs. gap), R162 (vs. gap), Y282 (= Y288)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
27% identity, 94% coverage: 17:334/338 of query aligns to 3:329/333 of Q2I8V6
- ASTI 9:12 (≠ AANL 23:26) binding
- S10 (≠ A24) mutation to G: Almost no effect.
- A13 (= A27) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ D39) mutation to D: No activity.
- ST 33:34 (≠ DV 39:40) binding
- R38 (≠ A44) binding
- TTNELH 71:76 (≠ SSTDTH 75:80) binding
- EK 93:94 (= EK 97:98) binding
- K94 (= K98) mutation to G: Less than 1% remaining activity.
- N120 (≠ G124) binding
- WR 162:163 (vs. gap) binding
- D176 (= D175) mutation to A: Less than 1% remaining activity.
- H180 (= H179) mutation to A: Less than 2% remaining activity.
- G206 (≠ A208) mutation to I: No effect.
- Y283 (= Y288) binding
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
26% identity, 97% coverage: 8:334/338 of query aligns to 2:336/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R17), F152 (≠ S155), N154 (≠ D157), D175 (= D175), L176 (≠ M176), H179 (= H179), E236 (≠ Y240), W271 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G16), F11 (≠ R17), M12 (≠ I18), D33 (= D39), L34 (≠ V40), T70 (≠ C74), T71 (≠ S75), P72 (≠ S76), N73 (≠ T77), L75 (≠ T79), H76 (= H80), Q79 (≠ L83), E93 (= E97), K94 (= K98), N122 (≠ Q126), W161 (≠ Y165), H179 (= H179), Y290 (= Y288)
Query Sequence
>BPHYT_RS13885 FitnessBrowser__BFirm:BPHYT_RS13885
MTDGAKTIDVAVFGAGRIGKIHAANLARQPGVRLKYVVDVNREAAAALAAEHGAQVADID
GAMGDASIGATVICSSTDTHADLILQSAAQKKHVFCEKPVDLTLERARACADAVERAGVV
CMIGFQRRFDPTFSALKARLDAGEIGTPEMLVVTSRDPGAPPVEYIKHSGGIFKDMLIHD
FDIFRWILDDEAETLHATGSCLSDPAIAEAGDIDSTAVTIRTKRGRLCQINTARRAAYGY
DQRFEVLGSHGMLQAGNVRPTEVTAYSKTEVSSDVPEAFFLERYRAAYAHEIAHFFDAVT
HGKPVRTTVADGLKALELAEAATRSWREGRAIKLGEAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory