SitesBLAST
Comparing BPHYT_RS15795 FitnessBrowser__BFirm:BPHYT_RS15795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
55% identity, 100% coverage: 1:281/281 of query aligns to 1:281/281 of 5c7hA
- active site: D52 (= D52), Y57 (= Y57), K82 (= K82), H115 (= H115)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G22), T23 (= T23), W24 (= W24), D52 (= D52), Y57 (= Y57), H115 (= H115), Q167 (= Q167), Y195 (= Y195), S196 (= S196), P197 (= P197), L198 (≠ V198), E200 (≠ H200), L204 (≠ P204), A221 (≠ F221), I237 (= I237), P238 (= P238), K239 (= K239), T240 (≠ A240), R245 (≠ H245), E248 (≠ D248), N249 (= N249), I281 (≠ L281)
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
55% identity, 100% coverage: 1:281/281 of query aligns to 1:281/281 of 4pmjA
- active site: D52 (= D52), Y57 (= Y57), K82 (= K82), H115 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G22), T23 (= T23), W24 (= W24), D52 (= D52), H115 (= H115), Q167 (= Q167), Y195 (= Y195), S196 (= S196), P197 (= P197), L198 (≠ V198), E200 (≠ H200), L204 (≠ P204), A221 (≠ F221), I237 (= I237), P238 (= P238), K239 (= K239), T240 (≠ A240), G241 (≠ A241), R245 (≠ H245), E248 (≠ D248), N249 (= N249)
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
52% identity, 98% coverage: 7:281/281 of query aligns to 4:283/283 of 4wghA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), T20 (= T23), W21 (= W24), D49 (= D52), Y54 (= Y57), N142 (= N145), Q164 (= Q167), Y192 (= Y195), C193 (≠ S196), P194 (= P197), L195 (≠ V198), Q197 (≠ H200), A198 (= A201), R200 (vs. gap), A223 (≠ F221), I239 (= I237), P240 (= P238), K241 (= K239), A242 (= A240), A243 (= A241), S244 (≠ R242), H247 (= H245), N251 (= N249)
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
52% identity, 98% coverage: 7:281/281 of query aligns to 5:284/284 of 6ciaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G22), T21 (= T23), W22 (= W24), D50 (= D52), Y55 (= Y57), H113 (= H115), N143 (= N145), Q165 (= Q167), Y193 (= Y195), C194 (≠ S196), P195 (= P197), L196 (≠ V198), Q198 (≠ H200), A199 (= A201), A224 (≠ F221), I240 (= I237), P241 (= P238), K242 (= K239), A243 (= A240), A244 (= A241), S245 (≠ R242), H248 (= H245), N252 (= N249)
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
41% identity, 91% coverage: 13:267/281 of query aligns to 10:272/274 of 5danA
- active site: D53 (= D52), Y58 (= Y57), K84 (= K82), H117 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), T20 (= T23), W21 (= W24), D53 (= D52), Y58 (= Y57), H117 (= H115), Q169 (= Q167), Y198 (= Y195), S199 (= S196), P200 (= P197), L201 (≠ V198), R203 (≠ H200), Y226 (≠ F221), I242 (= I237), P243 (= P238), K244 (= K239), G246 (≠ A241), R247 (= R242), H250 (= H245), E253 (≠ D248), N254 (= N249)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
41% identity, 91% coverage: 13:267/281 of query aligns to 11:273/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W24), Y59 (= Y57), W87 (≠ Y84), H118 (= H115), R204 (≠ H200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G22), T21 (= T23), W22 (= W24), Y59 (= Y57), H118 (= H115), N149 (= N145), Q170 (= Q167), Y199 (= Y195), S200 (= S196), P201 (= P197), L202 (≠ V198), R204 (≠ H200), T205 (≠ A201), Y227 (≠ F221), I243 (= I237), P244 (= P238), K245 (= K239), G247 (≠ A241), R248 (= R242), H251 (= H245), E254 (≠ D248), N255 (= N249)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
41% identity, 91% coverage: 13:267/281 of query aligns to 11:273/275 of 6kikA
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 77% coverage: 18:233/281 of query aligns to 15:273/331 of P80874
- TW 20:21 (= TW 23:24) binding
- D52 (= D52) binding
- Q175 (= Q167) binding
- YGSLCR 203:208 (≠ Y----- 195) binding
- K214 (vs. gap) binding
- R227 (vs. gap) binding
Sites not aligning to the query:
- 280:282 binding
- 286 binding
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
32% identity, 77% coverage: 18:233/281 of query aligns to 15:273/333 of 1pz1A
- active site: D52 (= D52), Y57 (= Y57), K90 (≠ P85), Q93 (vs. gap), H125 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), W21 (= W24), Q175 (= Q167), Y203 (= Y195), G204 (vs. gap), L206 (vs. gap), R208 (vs. gap), K214 (vs. gap)
Sites not aligning to the query:
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
29% identity, 93% coverage: 7:267/281 of query aligns to 11:263/281 of 1vbjA
- active site: D52 (= D52), Y57 (= Y57), K82 (= K82), H115 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G26 (= G22), M27 (≠ T23), W28 (= W24), D52 (= D52), Y57 (= Y57), H115 (= H115), N145 (= N145), Q166 (= Q167), W192 (≠ Y195), S193 (= S196), P194 (= P197), L195 (≠ V198), Q197 (≠ H200), G198 (≠ A201), V201 (≠ P204), A218 (≠ F221), I233 (= I237), K235 (= K239), S236 (≠ A240), G237 (≠ A241), R241 (≠ H245), E244 (≠ D248), N245 (= N249)
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
29% identity, 93% coverage: 7:266/281 of query aligns to 6:257/276 of Q9GV41
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
29% identity, 93% coverage: 6:267/281 of query aligns to 6:267/283 of 4g5dA
- active site: D48 (= D52), Y53 (= Y57), K78 (= K82), H111 (= H115)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G22), V23 (≠ T23), W24 (= W24), D48 (= D52), Y53 (= Y57), H111 (= H115), S148 (= S144), N149 (= N145), Q170 (≠ N171), W196 (≠ Y195), S197 (= S196), P198 (= P197), L199 (≠ V198), Q201 (≠ H200), G202 (≠ A201), L205 (≠ P204), I237 (= I237), P238 (= P238), K239 (= K239), S240 (≠ A240), V241 (≠ A241), H242 (≠ R242), R245 (≠ H245), E248 (≠ D248), N249 (= N249)
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 92% coverage: 8:265/281 of query aligns to 5:255/275 of A0QV10
Sites not aligning to the query:
- 262 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1m9hA Corynebacterium 2,5-dkgr a and phe 22 replaced with tyr (f22y), lys 232 replaced with gly (k232g), arg 238 replaced with his (r238h)and ala 272 replaced with gly (a272g)in presence of nadh cofactor (see paper)
32% identity, 94% coverage: 5:267/281 of query aligns to 2:259/277 of 1m9hA
- active site: D44 (= D52), Y49 (= Y57), K74 (= K82), H107 (= H115)
- binding nicotinamide-adenine-dinucleotide: G19 (= G22), Y21 (≠ W24), Y49 (= Y57), H107 (= H115), Q160 (= Q167), W186 (≠ Y195), G187 (≠ S196), P188 (= P197), L189 (≠ V198), Q191 (≠ H200), A214 (≠ F221), F229 (≠ I237), P230 (= P238), G231 (≠ K239), H237 (= H245), N241 (= N249)
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
30% identity, 82% coverage: 37:266/281 of query aligns to 30:289/301 of 6ow0B
Sites not aligning to the query:
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
28% identity, 95% coverage: 1:266/281 of query aligns to 8:268/288 of 4gieA
- active site: D55 (= D52), Y60 (= Y57), K85 (= K82), H118 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G22), W31 (= W24), D55 (= D52), Y60 (= Y57), H118 (= H115), W119 (= W116), N148 (= N145), Q169 (≠ V172), W195 (≠ Y195), S196 (= S196), P197 (= P197), L198 (≠ V198), S200 (vs. gap), L207 (≠ P204), A224 (≠ F221), I239 (= I237), P240 (= P238), K241 (= K239), S242 (≠ A240), R247 (≠ H245), E250 (≠ D248), N251 (= N249)
A0QV09 Aldo-keto reductase MSMEG_2407/MSMEI_2346; AKR; AKR5H1; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 95% coverage: 5:271/281 of query aligns to 11:275/283 of A0QV09
- G196 (≠ S196) binding
- L198 (≠ V198) binding
- V200 (≠ H200) binding
- I236 (= I237) binding
- R238 (≠ K239) binding
- S239 (≠ A240) binding
- A240 (= A241) binding
- R244 (≠ H245) binding
- S247 (≠ D248) binding
- N248 (= N249) binding
- R274 (≠ K270) binding
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
29% identity, 95% coverage: 5:271/281 of query aligns to 2:266/274 of 2wzmA
- active site: D44 (= D52), Y49 (= Y57), K74 (= K82), H107 (= H115)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (= Y195), G187 (≠ S196), P188 (= P197), L189 (≠ V198), G190 (≠ D199), V191 (≠ H200), G192 (≠ A201), L195 (≠ P204), A212 (≠ F221), I227 (= I237), R229 (≠ K239), S230 (≠ A240), R235 (≠ H245), N239 (= N249), R265 (≠ K270)
P06632 2,5-diketo-D-gluconic acid reductase A; 2,5-DKG reductase A; 2,5-DKGR A; 25DKGR-A; AKR5C; EC 1.1.1.346 from Corynebacterium sp. (strain ATCC 31090) (see 3 papers)
32% identity, 94% coverage: 5:267/281 of query aligns to 3:260/278 of P06632
- Y50 (= Y57) active site, Proton donor
- H108 (= H115) binding
- 188:242 (vs. 196:249, 30% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1a80A Native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. Complexed with NADPH (see paper)
32% identity, 94% coverage: 5:267/281 of query aligns to 2:259/277 of 1a80A
- active site: D44 (= D52), Y49 (= Y57), K74 (= K82), H107 (= H115)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), F21 (≠ W24), D44 (= D52), Y49 (= Y57), H107 (= H115), S138 (= S144), Q160 (= Q167), W186 (≠ Y195), G187 (≠ S196), P188 (= P197), L189 (≠ V198), Q191 (≠ H200), A214 (≠ F221), F229 (≠ I237), K231 (= K239), S232 (≠ A240), V233 (≠ A241), R234 (= R242), R237 (≠ H245), E240 (≠ D248), N241 (= N249)
Query Sequence
>BPHYT_RS15795 FitnessBrowser__BFirm:BPHYT_RS15795
MTSEIASVSLPDGERIPKLGQGTWEMGELPARRAAEIDALRCGIELGMTLIDTAEMYGDG
ATESLLGEALAGLRDKVFRVSKVYPHNASRRGVIAACEQSLKRLKTDQLDLYLLHWRGSV
PLAETVEGFEALRRAGKIRHWGVSNFDTEDMEELVATPGGDACATNQILYNVARRGPEFD
LLPWLAARKMPGMAYSPVDHARLPRRSPLDDIADARGVSVFQIALAWVLRQPGVCAIPKA
ARVEHVRDNHRASQLQLGADELAAIDAHFKPPRGKRPLEML
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory