SitesBLAST
Comparing BPHYT_RS20760 FitnessBrowser__BFirm:BPHYT_RS20760 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
32% identity, 98% coverage: 5:320/322 of query aligns to 3:315/325 of 3rc1A
- active site: K95 (= K98), Y179 (= Y182)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ A12), A11 (= A13), D12 (≠ K14), I13 (= I15), S35 (= S37), R36 (= R38), Y56 (= Y59), P71 (= P74), L72 (= L75), P73 (= P76), H77 (= H80), E94 (= E97), K95 (= K98), I162 (≠ L165), R163 (≠ K166), V168 (≠ L171), D175 (= D178), Y179 (= Y182)
- binding phosphate ion: H278 (≠ V282), K283 (≠ A287)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ N18), R17 (≠ F19), F152 (= F155), I154 (≠ Y157), P155 (≠ F158), Y233 (≠ R235), T253 (≠ N255)
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
32% identity, 98% coverage: 5:320/322 of query aligns to 10:322/332 of B3TMR8
- 17:23 (vs. 12:18, 43% identical) binding
- SR 42:43 (= SR 37:38) binding
- Y63 (= Y59) binding
- L79 (= L75) binding
- H84 (= H80) binding
- K102 (= K98) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (≠ K166) binding
- D182 (= D178) binding
- Y186 (= Y182) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
32% identity, 77% coverage: 5:253/322 of query aligns to 3:252/334 of Q7JK39
- H79 (= H80) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (= Y182) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
32% identity, 77% coverage: 5:253/322 of query aligns to 3:252/334 of Q9TQS6
- R148 (≠ K149) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
- R202 (≠ P206) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
32% identity, 77% coverage: 5:253/322 of query aligns to 2:251/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
32% identity, 77% coverage: 5:253/322 of query aligns to 2:251/331 of 2o4uX
- binding phosphate ion: L2 (≠ V5), S8 (≠ G11), V9 (≠ A12), A35 (≠ S37), R36 (= R38), R40 (= R42), Y57 (= Y59), N101 (= N103), A103 (= A105), D145 (≠ E147), R147 (≠ K149), K155 (≠ T156), Q232 (≠ A234), S234 (≠ R236), T236 (≠ H238), Q247 (≠ S249), N250 (≠ A252)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
26% identity, 99% coverage: 4:322/322 of query aligns to 3:326/336 of 5a06A
- active site: K101 (= K98), Y186 (= Y182)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ A12), G12 (≠ A13), Y13 (≠ K14), Y14 (≠ I15), S36 (= S37), G37 (≠ R38), T38 (≠ D39), K41 (≠ R42), Y59 (vs. gap), I77 (≠ P74), T78 (≠ L75), P79 (= P76), N80 (≠ T77), L82 (≠ S79), H83 (= H80), E100 (= E97), K101 (= K98), R129 (vs. gap), W168 (≠ L165), R169 (≠ K166), Y186 (= Y182), Y264 (= Y259)
- binding sorbitol: D72 (= D69), H96 (= H93), K101 (= K98), R122 (vs. gap), R122 (vs. gap), L124 (= L119), F160 (≠ Y157), R169 (≠ K166), D182 (= D178), Y186 (= Y182), K287 (≠ V282), H296 (≠ D291), E299 (≠ N294), E306 (≠ A301), G310 (≠ F305), G311 (≠ S306)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 99% coverage: 4:322/322 of query aligns to 3:326/336 of 5a03C
- active site: K101 (= K98), Y186 (= Y182)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), L11 (≠ A12), G12 (≠ A13), Y13 (≠ K14), Y14 (≠ I15), S36 (= S37), G37 (≠ R38), T38 (≠ D39), K41 (≠ R42), Y59 (vs. gap), I77 (≠ P74), T78 (≠ L75), P79 (= P76), N80 (≠ T77), L82 (≠ S79), H83 (= H80), E100 (= E97), K101 (= K98), R129 (vs. gap), W168 (≠ L165), R169 (≠ K166), Y186 (= Y182), Y264 (= Y259)
- binding beta-D-xylopyranose: K101 (= K98), F160 (≠ Y157), R169 (≠ K166), D182 (= D178), Y186 (= Y182)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 99% coverage: 4:322/322 of query aligns to 2:325/335 of 5a05A
- active site: K100 (= K98), Y185 (= Y182)
- binding beta-D-glucopyranose: K100 (= K98), F159 (≠ Y157), D181 (= D178), Y185 (= Y182)
- binding alpha-D-glucopyranose: P259 (≠ A252), S262 (= S258)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), L10 (≠ A12), G11 (≠ A13), Y12 (≠ K14), Y13 (≠ I15), S35 (= S37), G36 (≠ R38), T37 (≠ D39), K40 (≠ R42), Y58 (vs. gap), I76 (≠ P74), T77 (≠ L75), P78 (= P76), N79 (≠ T77), L81 (≠ S79), H82 (= H80), E99 (= E97), K100 (= K98), R128 (vs. gap), W167 (≠ L165), R168 (≠ K166), Y185 (= Y182), Y263 (= Y259)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 99% coverage: 4:322/322 of query aligns to 2:325/335 of 5a04A
- active site: K100 (= K98), Y185 (= Y182)
- binding beta-D-glucopyranose: K100 (= K98), F159 (≠ Y157), R168 (≠ K166), D181 (= D178), Y185 (= Y182)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ A12), G11 (≠ A13), Y12 (≠ K14), Y13 (≠ I15), S35 (= S37), G36 (≠ R38), T37 (≠ D39), K40 (≠ R42), Y58 (vs. gap), I76 (≠ P74), T77 (≠ L75), P78 (= P76), N79 (≠ T77), L81 (≠ S79), H82 (= H80), E99 (= E97), K100 (= K98), R128 (vs. gap), W167 (≠ L165), R168 (≠ K166), Y185 (= Y182), Y263 (= Y259)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 99% coverage: 4:322/322 of query aligns to 2:325/335 of 5a03E
- active site: K100 (= K98), Y185 (= Y182)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), L10 (≠ A12), G11 (≠ A13), Y12 (≠ K14), Y13 (≠ I15), S35 (= S37), G36 (≠ R38), T37 (≠ D39), K40 (≠ R42), Y58 (vs. gap), I76 (≠ P74), T77 (≠ L75), P78 (= P76), N79 (≠ T77), H82 (= H80), E99 (= E97), K100 (= K98), R128 (vs. gap), W167 (≠ L165), R168 (≠ K166), Y185 (= Y182), Y263 (= Y259)
- binding beta-D-xylopyranose: K100 (= K98), F159 (≠ Y157), R168 (≠ K166), D181 (= D178), Y185 (= Y182), E205 (≠ Q199), T207 (≠ E201), R209 (≠ V203)
- binding alpha-D-xylopyranose: H134 (≠ A128), M268 (≠ V264), R279 (≠ H275), E280 (≠ T276)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
26% identity, 99% coverage: 4:322/322 of query aligns to 2:325/335 of 5a02A
- active site: K100 (= K98), Y185 (= Y182)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ A12), G11 (≠ A13), Y12 (≠ K14), Y13 (≠ I15), S35 (= S37), G36 (≠ R38), T37 (≠ D39), K40 (≠ R42), Y58 (vs. gap), I76 (≠ P74), T77 (≠ L75), P78 (= P76), L81 (≠ S79), H82 (= H80), E99 (= E97), K100 (= K98), R128 (vs. gap), W167 (≠ L165), R168 (≠ K166), Y185 (= Y182), Y263 (= Y259)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
35% identity, 44% coverage: 6:146/322 of query aligns to 3:142/333 of Q2I8V6
- ASTI 9:12 (≠ AAKI 12:15) binding
- S10 (≠ A13) mutation to G: Almost no effect.
- A13 (= A16) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S37) mutation to D: No activity.
- ST 33:34 (≠ SR 37:38) binding
- R38 (= R42) binding
- TTNELH 71:76 (≠ LPTASH 75:80) binding
- EK 93:94 (= EK 97:98) binding
- K94 (= K98) mutation to G: Less than 1% remaining activity.
- N120 (≠ A124) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
35% identity, 44% coverage: 6:146/322 of query aligns to 2:141/332 of 2glxA
- active site: K93 (= K98)
- binding acetate ion: K93 (= K98)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G11), A8 (= A12), S9 (≠ A13), T10 (≠ K14), I11 (= I15), S32 (= S37), T33 (≠ R38), R37 (= R42), S69 (≠ P74), T70 (≠ L75), N72 (≠ T77), H75 (= H80), E92 (= E97), K93 (= K98), H121 (≠ M126)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
35% identity, 44% coverage: 5:146/322 of query aligns to 2:142/333 of 4koaA
- active site: K94 (= K98)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), A9 (= A12), S10 (≠ A13), T11 (≠ K14), I12 (= I15), S33 (= S37), S34 (≠ R38), R38 (= R42), T71 (≠ L75), N73 (≠ T77), H76 (= H80), K94 (= K98)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
25% identity, 63% coverage: 4:206/322 of query aligns to 31:241/381 of 1rydA
- active site: K129 (= K98), Y217 (= Y182)
- binding alpha-D-glucopyranose: Y236 (≠ E201)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ A12), G40 (≠ A13), K41 (= K14), Y42 (≠ I15), S64 (= S37), G65 (≠ R38), K69 (≠ R42), Y87 (vs. gap), L106 (= L75), P107 (= P76), N108 (≠ T77), L110 (≠ S79), H111 (= H80), E128 (= E97), K129 (= K98), R157 (≠ M126), A196 (≠ G163), W199 (vs. gap), R200 (vs. gap), Y217 (= Y182)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
25% identity, 63% coverage: 4:206/322 of query aligns to 33:243/383 of 1h6dA
- active site: K131 (= K98), Y219 (= Y182)
- binding glycerol: K131 (= K98), R202 (vs. gap), D215 (= D178), Y219 (= Y182)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G11), L41 (≠ A12), G42 (≠ A13), K43 (= K14), Y44 (≠ I15), S66 (= S37), G67 (≠ R38), K71 (≠ R42), Y89 (vs. gap), I107 (≠ P74), L108 (= L75), P109 (= P76), N110 (≠ T77), H113 (= H80), E130 (= E97), K131 (= K98), R159 (≠ M126), A198 (≠ G163), W201 (vs. gap), R202 (vs. gap), Y219 (= Y182)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
25% identity, 63% coverage: 4:206/322 of query aligns to 2:212/340 of 1evjA
- active site: K100 (= K98), Y188 (= Y182)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), L10 (≠ A12), G11 (≠ A13), K12 (= K14), Y13 (≠ I15), D35 (≠ S37), L77 (= L75), P78 (= P76), N79 (≠ T77), H82 (= H80), E99 (= E97), K100 (= K98), R128 (≠ M126), W170 (vs. gap), R171 (vs. gap), Y188 (= Y182)
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
37% identity, 40% coverage: 54:182/322 of query aligns to 50:178/348 of 3e18A
- active site: K94 (= K98), H178 (≠ Y182)
- binding nicotinamide-adenine-dinucleotide: A70 (≠ P74), T71 (≠ L75), P72 (= P76), N73 (≠ T77), H76 (= H80), E93 (= E97), K94 (= K98), N122 (≠ H130), W161 (≠ L165), R162 (≠ K166), H178 (≠ Y182)
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
27% identity, 77% coverage: 4:250/322 of query aligns to 3:256/325 of 1zh8A
- active site: K98 (= K98), H187 (≠ Y182)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), C11 (≠ A12), G12 (≠ A13), I13 (≠ K14), A14 (≠ I15), S37 (= S37), R38 (= R38), T39 (≠ D39), H42 (≠ R42), T74 (≠ P74), L75 (= L75), P76 (= P76), L79 (≠ S79), E97 (= E97), K98 (= K98), N126 (≠ M126), Y165 (≠ A170), W170 (vs. gap), R171 (vs. gap), H187 (≠ Y182)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS20760 FitnessBrowser__BFirm:BPHYT_RS20760
MTDRVRWGVLGAAKIANNFVVPALQRSRNGRVTMVASRDLARAQAFATKHDIARVSASYE
EVIASQDVDAIYIPLPTASHFEWCKKALLGGKHVLCEKPIAMNTAEVEELIALRDQTGLV
CGEAFMVAHHPQWAYVRDSLAQGLIGELKLVEGSFTYFNDDPGALKNNLALGGGGVRDIG
VYPVVTARLATGLEPDRIQSEIVLDPRFGTDRFARCVADFPGFTLSFYCGTQMARRQHMM
FHGTKGWLSVDAPFNPGSYGPAKVRHRRDATGSEHTQEFSDVDQYQAMVEDFSNTVIGGT
AGLVFSLESSLANQRVIDQILR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory