Comparing BPHYT_RS22155 FitnessBrowser__BFirm:BPHYT_RS22155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
33% identity, 87% coverage: 6:259/291 of query aligns to 2:255/263 of 4iztA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
33% identity, 87% coverage: 6:259/291 of query aligns to 1:254/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
33% identity, 87% coverage: 6:259/291 of query aligns to 1:254/262 of 5ny7A
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
34% identity, 79% coverage: 13:241/291 of query aligns to 2:229/254 of 4izuA
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
26% identity, 85% coverage: 13:259/291 of query aligns to 1:243/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
26% identity, 85% coverage: 13:259/291 of query aligns to 1:243/261 of 3klcA
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
34% identity, 81% coverage: 6:241/291 of query aligns to 1:236/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
34% identity, 81% coverage: 6:241/291 of query aligns to 1:236/261 of 4izsA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
26% identity, 85% coverage: 13:259/291 of query aligns to 2:244/262 of Q9UYV8
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
27% identity, 93% coverage: 11:282/291 of query aligns to 2:275/276 of Q9NQR4
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
26% identity, 93% coverage: 7:276/291 of query aligns to 1:267/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
25% identity, 91% coverage: 13:276/291 of query aligns to 3:261/263 of 7ovgA
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 86% coverage: 12:261/291 of query aligns to 36:295/307 of Q94JV5
Sites not aligning to the query:
Q03217 Aliphatic nitrilase; EC 3.5.5.7 from Rhodococcus rhodochrous (see paper)
30% identity, 45% coverage: 11:140/291 of query aligns to 6:146/366 of Q03217
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
24% identity, 90% coverage: 15:276/291 of query aligns to 7:297/304 of Q44185
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
24% identity, 90% coverage: 15:276/291 of query aligns to 6:296/303 of 8hpcC
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
23% identity, 82% coverage: 12:251/291 of query aligns to 2:241/526 of 5khaA
Sites not aligning to the query:
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
24% identity, 90% coverage: 15:276/291 of query aligns to 6:296/303 of 1uf8A
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
24% identity, 90% coverage: 15:276/291 of query aligns to 6:296/303 of 1uf7A
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
24% identity, 90% coverage: 15:276/291 of query aligns to 6:296/303 of 1uf5A
>BPHYT_RS22155 FitnessBrowser__BFirm:BPHYT_RS22155
MNHIQALLPQTSLRIAAAQAQPISGDVTGNIARTVELTALAADAGAKLVVFPEKFLTGYE
PDLIAGDPAKYAFDAHDARLEPIRDICRQREIAVIVGAATRGERGLHISSLVFSRSGAQL
DSYHKQYLYSSETRIYQPGTQGRMLELDGWRLALGVCYDSGFAEHARHAAVNGAHAYLVS
ALFSVQTGYHQSRIWFPARAFDNTMYALLSNHVGTTGGWATCGASAIWSPSGDVIAQASR
EREEVITALLDPAVLADVRERETMLADFRERDEAVHAIRYNEAHYPSGDSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory